DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and igsf9a

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_005155702.1 Gene:igsf9a / 557459 ZFINID:ZDB-GENE-060503-288 Length:1619 Species:Danio rerio


Alignment Length:283 Identity:62/283 - (21%)
Similarity:104/283 - (36%) Gaps:63/283 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GRVSGPGAGTS--------EGAGTSSASAASTAISSDESGDPSSATAFSSLAQVSSLLPEASALS 109
            ||||..| |||        |..|...........:::|:|...|.|..|..|             
Zfish    84 GRVSLFG-GTSLQMSGLQLEDEGWYECRILPLDQTTEEAGSSGSWTRLSVTA------------- 134

  Fly   110 ATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFL 174
                  .|.|...:...|...:|....|.|..:.....:::|  .:||..:.....|.:.:    
Zfish   135 ------PPVLTETSPPEVEVFVGRSLTLKCAAQGNPRPTITW--SKDGAPIKPQHKVKMVN---- 187

  Fly   175 AIKQPDKYWTLQIKYVQARDAGSYECQVS-TEPKVSARVQLQVVVPRTEILGEPDRYVKAGSNVV 238
                    .::....|....||.|:|..| :|...:...:|:::.|...|:...|..:....:..
Zfish   188 --------GSVSFHAVSREAAGQYQCYTSNSEGNATHVTRLKIIGPPVIIIPPSDTVLNMSQDAK 244

  Fly   239 LRCIVRGALEPP--TFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDT 301
            |:|  :...:||  |::....|.:....||.:.|.::..:            |:|:|......|:
Zfish   245 LKC--QAEADPPNMTYVWQRQGVDIYHIDSLKSRIKVIVD------------GTLLISRLAPEDS 295

  Fly   302 GNYTCSPSN----SPSATVTLNI 320
            |||||.|:|    ||||:..|.:
Zfish   296 GNYTCMPTNGLPVSPSASAVLTV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 16/91 (18%)
Ig 127..217 CDD:299845 16/90 (18%)
IG_like 227..320 CDD:214653 26/98 (27%)
IGc2 234..311 CDD:197706 20/82 (24%)
igsf9aXP_005155702.1 IG_like 27..110 CDD:214653 10/26 (38%)
Ig 35..111 CDD:299845 10/27 (37%)
I-set 140..221 CDD:254352 15/94 (16%)
IGc2 151..212 CDD:197706 13/74 (18%)
Ig 233..318 CDD:299845 26/98 (27%)
I-set 233..318 CDD:254352 26/98 (27%)
Ig <349..402 CDD:299845
IG_like 423..502 CDD:214653
Ig 435..498 CDD:143165
FN3 507..602 CDD:238020
fn3 614..696 CDD:278470
PHA02666 1105..>1312 CDD:222914
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.