DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and KIRREL1

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:215 Identity:63/215 - (29%)
Similarity:93/215 - (43%) Gaps:38/215 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 TTQIGTHAYLPCRVKQLGNKS--VSWIRLRDGHILTVDRAVFIADQRFLAIKQPDK-YWTLQIKY 189
            |...|..|.|||   .|.|.|  |.|  .:||..|.:.:.: .|..|:..:...|. .:.|:|..
Human    31 TVVAGQRAVLPC---VLLNYSGIVQW--TKDGLALGMGQGL-KAWPRYRVVGSADAGQYNLEITD 89

  Fly   190 VQARDAGSYECQVSTEPKVSARVQLQVVVP--RTEILGEPDRYVKAGSNVVLRCIVRGALEPPTF 252
            .:..|..|||||.:.....|.|.:|.|::|  .|.|.|.|...::||:...|.|....| :|...
Human    90 AELSDDASYECQATEAALRSRRAKLTV
LIPPEDTRIDGGPVILLQAGTPHNLTCRAFNA-KPAAT 153

  Fly   253 IMWYH-GAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGN-YTCSPSNS--PS 313
            |:|:. |.:|..|.:   .|:|     ...|:.::|:..|:| :....|.|. :||...|.  ||
Human   154 IIWFRDGTQQEGAVA---STEL-----LKDGKRETTVSQLLI-NPTDLDIGRVFTCRSMNEAIPS 209

  Fly   314 A-------------TVTLNI 320
            .             ||||:|
Human   210 GKETSIELDVHHPPTVTLSI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 28/90 (31%)
Ig 127..217 CDD:299845 28/91 (31%)
IG_like 227..320 CDD:214653 29/109 (27%)
IGc2 234..311 CDD:197706 20/78 (26%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 28/90 (31%)
Ig 25..116 CDD:299845 28/90 (31%)
Ig2_KIRREL3-like 138..219 CDD:143236 22/90 (24%)
I-set 223..304 CDD:254352 5/7 (71%)
Ig_2 227..305 CDD:290606 2/3 (67%)
Ig_2 311..405 CDD:290606
IG_like 314..405 CDD:214653
Ig5_KIRREL3 407..504 CDD:143306
IG_like 416..504 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.