Sequence 1: | NP_001262320.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005245362.1 | Gene: | KIRREL1 / 55243 | HGNCID: | 15734 | Length: | 773 | Species: | Homo sapiens |
Alignment Length: | 215 | Identity: | 63/215 - (29%) |
---|---|---|---|
Similarity: | 93/215 - (43%) | Gaps: | 38/215 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 128 TTQIGTHAYLPCRVKQLGNKS--VSWIRLRDGHILTVDRAVFIADQRFLAIKQPDK-YWTLQIKY 189
Fly 190 VQARDAGSYECQVSTEPKVSARVQLQVVVP--RTEILGEPDRYVKAGSNVVLRCIVRGALEPPTF 252
Fly 253 IMWYH-GAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGN-YTCSPSNS--PS 313
Fly 314 A-------------TVTLNI 320 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr11 | NP_001262320.1 | I-set | 125..216 | CDD:254352 | 28/90 (31%) |
Ig | 127..217 | CDD:299845 | 28/91 (31%) | ||
IG_like | 227..320 | CDD:214653 | 29/109 (27%) | ||
IGc2 | 234..311 | CDD:197706 | 20/78 (26%) | ||
KIRREL1 | XP_005245362.1 | I-set | 22..116 | CDD:254352 | 28/90 (31%) |
Ig | 25..116 | CDD:299845 | 28/90 (31%) | ||
Ig2_KIRREL3-like | 138..219 | CDD:143236 | 22/90 (24%) | ||
I-set | 223..304 | CDD:254352 | 5/7 (71%) | ||
Ig_2 | 227..305 | CDD:290606 | 2/3 (67%) | ||
Ig_2 | 311..405 | CDD:290606 | |||
IG_like | 314..405 | CDD:214653 | |||
Ig5_KIRREL3 | 407..504 | CDD:143306 | |||
IG_like | 416..504 | CDD:214653 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |