DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and iglon5

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:318 Identity:67/318 - (21%)
Similarity:107/318 - (33%) Gaps:107/318 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GYATSNVTTQIGTHAYLPCRV-KQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWT 184
            |:...|:|...|....|.|:: :::.:|  :|  |...:||......:..|.|.......:..::
Zfish    30 GHLPDNITVLEGESVVLRCKIDEEVTHK--AW--LNRSNILFTGTDKWSLDSRVSLENNNNSDFS 90

  Fly   185 LQIKYVQARDAGSYEC--QVSTEPKVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGAL 247
            ::|:.|...|.|.|.|  |...:|: :|.|.|.|.||...:....|:.|..|.:|.|.|:..|..
Zfish    91 IRIERVMVADEGPYTCSFQARNKPR-TAHVYLIVQVPARIVNISQDKSVNEGEDVNLFCLAVGRP 154

  Fly   248 EPPTFIMW--------------------YHGAEQLAA---------DSRRHRTQLD--------P 275
            ||.  |.|                    .|.||....         |:|:.:..::        .
Zfish   155 EPT--ITWKDFKYGLLNEGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTVNYPPIITDVK 217

  Fly   276 NLPEASG-----------------------------------EGQSTIGSLIIESAKKRDTGNYT 305
            |:|...|                                   :.:.|...|:..:..::..||||
Zfish   218 NMPAQVGKTAILRCEAMAVPTASFEWYRDDRRPVESDNTLKIKNEKTRSLLLFTNVTEKHFGNYT 282

  Fly   306 CSPSNSPSATVTLNIINGESSAS-------AVTSSAATTRA--------YALSILALL 348
            |..||.          .|.|:||       ||...||:...        :.|||..|:
Zfish   283 CFASNR----------LGASNASMLLFRPGAVYGGAASLNGRLSGVGLWFCLSISVLM 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 23/93 (25%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 0/3 (0%)
Ig strand F 197..202 CDD:409353 2/6 (33%)
IG_like 227..320 CDD:214653 28/164 (17%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 2/23 (9%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
iglon5NP_001017775.2 Ig 35..123 CDD:472250 23/92 (25%)
Ig strand B 44..48 CDD:409353 1/3 (33%)
Ig strand C 56..60 CDD:409353 2/7 (29%)
Ig strand E 89..93 CDD:409353 0/3 (0%)
Ig strand F 103..108 CDD:409353 2/4 (50%)
Ig strand G 116..119 CDD:409353 1/2 (50%)
Ig 122..207 CDD:472250 19/86 (22%)
Ig strand B 144..148 CDD:409353 2/3 (67%)
Ig strand C 157..161 CDD:409353 1/5 (20%)
Ig strand E 172..176 CDD:409353 0/3 (0%)
Ig strand F 186..191 CDD:409353 0/4 (0%)
Ig strand G 200..203 CDD:409353 1/2 (50%)
Ig_3 210..287 CDD:464046 10/76 (13%)

Return to query results.
Submit another query.