DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and iglon5

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:318 Identity:67/318 - (21%)
Similarity:107/318 - (33%) Gaps:107/318 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GYATSNVTTQIGTHAYLPCRV-KQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWT 184
            |:...|:|...|....|.|:: :::.:|  :|  |...:||......:..|.|.......:..::
Zfish    30 GHLPDNITVLEGESVVLRCKIDEEVTHK--AW--LNRSNILFTGTDKWSLDSRVSLENNNNSDFS 90

  Fly   185 LQIKYVQARDAGSYEC--QVSTEPKVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGAL 247
            ::|:.|...|.|.|.|  |...:|: :|.|.|.|.||...:....|:.|..|.:|.|.|:..|..
Zfish    91 IRIERVMVADEGPYTCSFQARNKPR-TAHVYLIVQVPARIVNISQDKSVNEGEDVNLFCLAVGRP 154

  Fly   248 EPPTFIMW--------------------YHGAEQLAA---------DSRRHRTQLD--------P 275
            ||.  |.|                    .|.||....         |:|:.:..::        .
Zfish   155 EPT--ITWKDFKYGLLNEGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTVNYPPIITDVK 217

  Fly   276 NLPEASG-----------------------------------EGQSTIGSLIIESAKKRDTGNYT 305
            |:|...|                                   :.:.|...|:..:..::..||||
Zfish   218 NMPAQVGKTAILRCEAMAVPTASFEWYRDDRRPVESDNTLKIKNEKTRSLLLFTNVTEKHFGNYT 282

  Fly   306 CSPSNSPSATVTLNIINGESSAS-------AVTSSAATTRA--------YALSILALL 348
            |..||.          .|.|:||       ||...||:...        :.|||..|:
Zfish   283 CFASNR----------LGASNASMLLFRPGAVYGGAASLNGRLSGVGLWFCLSISVLM 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 23/93 (25%)
Ig 127..217 CDD:299845 22/92 (24%)
IG_like 227..320 CDD:214653 28/164 (17%)
IGc2 234..311 CDD:197706 25/148 (17%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 23/94 (24%)
Ig 35..123 CDD:299845 23/92 (25%)
Ig 125..>183 CDD:299845 13/59 (22%)
I-set 128..207 CDD:254352 16/80 (20%)
IG_like 217..298 CDD:214653 16/90 (18%)
ig 223..296 CDD:278476 13/82 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.