Sequence 1: | NP_001262320.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017775.2 | Gene: | iglon5 / 550472 | ZFINID: | ZDB-GENE-050417-297 | Length: | 332 | Species: | Danio rerio |
Alignment Length: | 318 | Identity: | 67/318 - (21%) |
---|---|---|---|
Similarity: | 107/318 - (33%) | Gaps: | 107/318 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 121 GYATSNVTTQIGTHAYLPCRV-KQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWT 184
Fly 185 LQIKYVQARDAGSYEC--QVSTEPKVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGAL 247
Fly 248 EPPTFIMW--------------------YHGAEQLAA---------DSRRHRTQLD--------P 275
Fly 276 NLPEASG-----------------------------------EGQSTIGSLIIESAKKRDTGNYT 305
Fly 306 CSPSNSPSATVTLNIINGESSAS-------AVTSSAATTRA--------YALSILALL 348 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr11 | NP_001262320.1 | I-set | 125..216 | CDD:254352 | 23/93 (25%) |
Ig | 127..217 | CDD:299845 | 22/92 (24%) | ||
IG_like | 227..320 | CDD:214653 | 28/164 (17%) | ||
IGc2 | 234..311 | CDD:197706 | 25/148 (17%) | ||
iglon5 | NP_001017775.2 | IG_like | 33..123 | CDD:214653 | 23/94 (24%) |
Ig | 35..123 | CDD:299845 | 23/92 (25%) | ||
Ig | 125..>183 | CDD:299845 | 13/59 (22%) | ||
I-set | 128..207 | CDD:254352 | 16/80 (20%) | ||
IG_like | 217..298 | CDD:214653 | 16/90 (18%) | ||
ig | 223..296 | CDD:278476 | 13/82 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |