DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Ntm

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001418383.1 Gene:Ntm / 50864 RGDID:620958 Length:367 Species:Rattus norvegicus


Alignment Length:354 Identity:82/354 - (23%)
Similarity:125/354 - (35%) Gaps:114/354 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SALSATSGLVEPYLDGYAT-----SNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRA 165
            :||....|:  |...|.||     .|||.:.|..|.|.|.:.....: |:|  |....||.....
  Rat    21 AALCLFQGV--PVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTR-VAW--LNRSTILYAGND 80

  Fly   166 VFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTE--PKVSARVQLQVVVPRTEILGEPD 228
            .:..|.|.:.:......::::|:.|...|.|.|.|.|.|:  ||.| ||.|.|.|....:....|
  Rat    81 KWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTS-RVHLIVQVSPKIVEISSD 144

  Fly   229 RYVKAGSNVVLRCIVRGALEPPTFIMWYH-------------------------GAEQLAADS-- 266
            ..:..|:|:.|.||..|..||.  :.|.|                         |..:.:|.:  
  Rat   145 ISINEGNNISLTCIATGRPEPT--VTWRHISPKAVGFVSEDEYLEIQGITREQSGEYECSASNDV 207

  Fly   267 -----RRHRTQLD--PNLPEASGEG------------QSTIGSL----------IIESAK----- 297
                 ||.:..::  |.:.||.|.|            .|.:.|.          ::|..|     
  Rat   208 AAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWFKDDKRLVEGKKGVKVE 272

  Fly   298 --------------KRDTGNYTCSPSNS---PSATVTLNIINGESSASAVTSSAATT-------- 337
                          :.|.|||||..||.   .:|::.|..:| |.::|.:.....||        
  Rat   273 NRPFLSRLTFFNVSEHDYGNYTCVASNKLGHTNASIMLFELN-EPTSSTLLQEVKTTALTPWKGP 336

  Fly   338 ------------RAYALSILALLLSVILI 354
                        ||..:.:|.||:..:|:
  Rat   337 GAVSEVNNGTSRRAGCIWLLPLLVLHLLL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 28/92 (30%)
Ig strand B 135..139 CDD:409353 2/3 (67%)
Ig strand C 148..152 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 0/3 (0%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 34/170 (20%)
Ig strand B 237..241 CDD:409544 1/3 (33%)
Ig strand C 252..256 CDD:409544 0/3 (0%)
Ig strand E 289..293 CDD:409544 1/13 (8%)
Ig strand G 313..316 CDD:409544 1/2 (50%)
NtmNP_001418383.1 Ig 44..132 CDD:472250 28/91 (31%)
Ig strand B 53..57 CDD:409382 2/3 (67%)
Ig strand C 65..69 CDD:409382 2/6 (33%)
Ig strand E 98..102 CDD:409382 0/3 (0%)
Ig strand F 112..117 CDD:409382 2/4 (50%)
Ig strand G 125..128 CDD:409382 1/3 (33%)
Ig_3 136..205 CDD:464046 13/70 (19%)
Ig 223..307 CDD:472250 17/83 (20%)
Ig strand B 239..243 CDD:409408 0/3 (0%)
Ig strand C 252..256 CDD:409408 0/3 (0%)
Ig strand E 278..282 CDD:409408 0/3 (0%)
Ig strand F 292..297 CDD:409408 4/4 (100%)

Return to query results.
Submit another query.