DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and NTM

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001338930.1 Gene:NTM / 50863 HGNCID:17941 Length:367 Species:Homo sapiens


Alignment Length:353 Identity:80/353 - (22%)
Similarity:126/353 - (35%) Gaps:112/353 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SALSATSGLVEPYLDGYAT-----SNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRA 165
            :||....|:  |...|.||     .|||.:.|..|.|.|.:.....: |:|  |....||.....
Human    21 AALCLFQGV--PVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTR-VAW--LNRSTILYAGND 80

  Fly   166 VFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTE--PKVSARVQLQVVVPRTEILGEPD 228
            .:..|.|.:.:......::::|:.|...|.|.|.|.|.|:  ||.| ||.|.|.|....:....|
Human    81 KWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTS-RVHLIVQVSPKIVEISSD 144

  Fly   229 RYVKAGSNVVLRCIVRGALEPPTFIMWYH-------------------------GAEQLAADS-- 266
            ..:..|:|:.|.||..|..||.  :.|.|                         |..:.:|.:  
Human   145 ISINEGNNISLTCIATGRPEPT--VTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDV 207

  Fly   267 -----RRHRTQLD--PNLPEASG-----------------------------------------E 283
                 ||.:..::  |.:.||.|                                         |
Human   208 AAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVE 272

  Fly   284 GQSTIGSLIIESAKKRDTGNYTCSPSNS---PSATVTLNIINGESSA--------SAVT------ 331
            .:..:..||..:..:.|.|||||..||.   .:|::.|..:|..:|:        :|:|      
Human   273 NRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEPTSSTLLQEVKTTALTPWKGPG 337

  Fly   332 -----SSAATTRAYALSILALLLSVILI 354
                 |:..:.||..:.:|.||:..:|:
Human   338 AVSEVSNGTSRRAGCVWLLPLLVLHLLL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 28/92 (30%)
Ig 127..217 CDD:299845 27/91 (30%)
IG_like 227..320 CDD:214653 32/170 (19%)
IGc2 234..311 CDD:197706 28/151 (19%)
NTMNP_001338930.1 Ig 44..132 CDD:416386 28/91 (31%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 2/8 (25%)
Ig strand C 64..70 CDD:409353 2/8 (25%)
CDR2 71..83 CDD:409353 2/11 (18%)
Ig strand C' 72..76 CDD:409353 1/3 (33%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 8/33 (24%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 6/9 (67%)
FR4 125..132 CDD:409353 4/7 (57%)
Ig_3 136..205 CDD:404760 13/70 (19%)
Ig strand A' 142..147 CDD:409353 1/4 (25%)
Ig strand B 153..160 CDD:409353 3/6 (50%)
Ig strand C 166..171 CDD:409353 1/6 (17%)
Ig strand D 177..180 CDD:409353 0/2 (0%)
Ig strand E 184..190 CDD:409353 0/5 (0%)
Ig strand F 197..204 CDD:409353 1/6 (17%)
Ig strand G 211..219 CDD:409353 2/7 (29%)
Ig_3 222..299 CDD:404760 13/76 (17%)
putative Ig strand A 223..229 CDD:409353 2/5 (40%)
Ig strand B 239..243 CDD:409353 0/3 (0%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.