DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and dpr12

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:243 Identity:92/243 - (37%)
Similarity:128/243 - (52%) Gaps:22/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 NVTTQIGTHAYLPCRVKQLGN-----KSVSWIRLRDGHILTVDRAVFIADQRFLAIKQP-DKYWT 184
            |.|.|:|..|:|.|:|..:..     ..:||||.||.|||:....::..|:||..:..| ...||
  Fly    86 NTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWT 150

  Fly   185 LQIKYVQARDAGSYECQVSTEPK-VSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGALE 248
            ||||:||.||.|.|||||||... :|..|.||||||...|||..:.:|..||.:.|.||:..:..
  Fly   151 LQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPT 215

  Fly   249 PPTFIMWYHGAEQL-AADSRRHRT-QLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNS 311
            ||.::.|......: ..||||..| :..|        |..|...|||...:..|:||||||.||:
  Fly   216 PPQYVYWQKNDRLINYVDSRRDITIETTP--------GPRTQSRLIIREPQVTDSGNYTCSASNT 272

  Fly   312 PSATVTLNIINGESSAS---AVTSSAATTRAYALSILA--LLLSVILI 354
            ..|::.:.:..|::.|:   ..||||........|:||  |||:.:::
  Fly   273 EPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLNTVVV 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 42/96 (44%)
Ig 127..217 CDD:299845 42/96 (44%)
IG_like 227..320 CDD:214653 30/94 (32%)
IGc2 234..311 CDD:197706 27/78 (35%)
dpr12NP_652462.3 IG 86..183 CDD:214652 42/96 (44%)
Ig_3 193..271 CDD:404760 27/85 (32%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.