DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and tutl

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:320 Identity:62/320 - (19%)
Similarity:107/320 - (33%) Gaps:135/320 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SNVTTQIGTHAYLPCRVKQL-GNKSVSWIR-----------------LRDGHIL-----TVDRAV 166
            :|.|...|......|..|.: ||.:|.|.|                 .:||.::     ..|...
  Fly   352 TNQTKLEGEKVIFSCEAKAMPGNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQ 416

  Fly   167 FIAD-----------QRFLAIKQPDKY-WTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVV- 218
            ::.:           ..:|:::.|.|. :|..::|:..|.||..:|.:.:.|      |||.|. 
  Fly   417 YLCEVTNGIGDPQSASAYLSVEYPAKVTFTPTVQYLPFRLAGVVQCYIKSSP------QLQYVTW 475

  Fly   219 PRTEILGEP------------------------DRYV--------KAGSNVVLRCIVRGALEPPT 251
            .:.:.|.||                        .:|.        .||::.|:..:||   :||.
  Fly   476 TKDKRLLEPYQMKDIVVMANGSLLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVR---KPPA 537

  Fly   252 F--------------------------------IMWYHGAEQLAADSRRHRTQLDPNLPEASGEG 284
            |                                |.|.....:...:|:|:|.::       ||  
  Fly   538 FTVEPETLYQRKVGDSVEMHCDALEAEGTERPTIKWQRQEGEQLTESQRNRIKI-------SG-- 593

  Fly   285 QSTIGSLIIESAKKRDTGNYTCSPSNSPS---ATVTLNI----------INGESSASAVT 331
                |::.||:.::.|.|.|.|..||..:   |...|.|          |.|:::.|::|
  Fly   594 ----GNITIENLRREDFGYYQCVVSNEVATLMAVTQLVIEGTQPHAPYNITGKATESSIT 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 25/125 (20%)
Ig 127..217 CDD:299845 25/124 (20%)
IG_like 227..320 CDD:214653 28/159 (18%)
IGc2 234..311 CDD:197706 22/108 (20%)
tutlNP_001303307.1 V-set 137..250 CDD:284989
IG_like 137..229 CDD:214653
I-set 253..341 CDD:254352
IGc2 268..331 CDD:197706
I-set 346..437 CDD:254352 14/84 (17%)
Ig 349..437 CDD:299845 14/84 (17%)
Ig 459..530 CDD:299845 13/76 (17%)
IG_like 549..628 CDD:214653 18/91 (20%)
IGc2 551..617 CDD:197706 16/78 (21%)
FN3 633..725 CDD:238020 4/17 (24%)
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.