| Sequence 1: | NP_001262320.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031751706.1 | Gene: | cadm2 / 448238 | XenbaseID: | XB-GENE-998536 | Length: | 441 | Species: | Xenopus tropicalis |
| Alignment Length: | 411 | Identity: | 82/411 - (19%) |
|---|---|---|---|
| Similarity: | 121/411 - (29%) | Gaps: | 167/411 - (40%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 95 LAQVSSLLPEASALSATSGLV---------EPYLDGY-ATSNVTTQIGTHAYLPCRVKQLGNKSV 149
Fly 150 SWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQL 214
Fly 215 QVV-VPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPN-- 276
Fly 277 --------------------------------------------------------LPEASGEGQ 285
Fly 286 STIGSLIIES-----------------------------------AKKRDTGNYTCSPSNS---- 311
Fly 312 ------------------------PSATVTLNIINGESSASAVTSSAATTR-------------- 338
Fly 339 ----AYALSILALLLSVILIG 355 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr11 | NP_001262320.1 | I-set | 125..216 | CDD:254352 | 25/90 (28%) |
| Ig | 127..217 | CDD:299845 | 24/89 (27%) | ||
| IG_like | 227..320 | CDD:214653 | 33/213 (15%) | ||
| IGc2 | 234..311 | CDD:197706 | 26/169 (15%) | ||
| cadm2 | XP_031751706.1 | IgV_1_Necl-3 | 34..129 | CDD:409498 | 26/95 (27%) |
| Ig strand B | 48..52 | CDD:409498 | 1/3 (33%) | ||
| Ig strand C | 61..65 | CDD:409498 | 1/3 (33%) | ||
| Ig strand E | 95..99 | CDD:409498 | 0/3 (0%) | ||
| Ig strand F | 109..114 | CDD:409498 | 2/4 (50%) | ||
| Ig strand G | 121..124 | CDD:409498 | 0/2 (0%) | ||
| IgI_2_Necl-3 | 128..231 | CDD:409467 | 15/105 (14%) | ||
| Ig strand B | 150..154 | CDD:409467 | 1/3 (33%) | ||
| Ig strand C | 164..168 | CDD:409467 | 1/3 (33%) | ||
| Ig strand E | 194..198 | CDD:409467 | 0/3 (0%) | ||
| Ig strand F | 208..213 | CDD:409467 | 0/4 (0%) | ||
| Ig strand G | 224..227 | CDD:409467 | 0/2 (0%) | ||
| IGc2 | 248..311 | CDD:197706 | 15/64 (23%) | ||
| Ig strand B | 250..259 | CDD:409353 | 5/10 (50%) | ||
| Ig strand C | 265..271 | CDD:409353 | 0/5 (0%) | ||
| Ig strand C' | 274..277 | CDD:409353 | 0/2 (0%) | ||
| Ig strand D | 280..285 | CDD:409353 | 0/4 (0%) | ||
| Ig strand E | 286..293 | CDD:409353 | 0/6 (0%) | ||
| Ig strand F | 300..308 | CDD:409353 | 3/7 (43%) | ||
| Ig strand G | 311..321 | CDD:409353 | 0/9 (0%) | ||
| 4.1m | 394..412 | CDD:128590 | 2/2 (100%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 82 | 1.000 | Inparanoid score | I5030 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.960 | |||||