DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and negr1

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:340 Identity:80/340 - (23%)
Similarity:116/340 - (34%) Gaps:100/340 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SGDPSSATAFSSLAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNK 147
            ||...:|...|....:.|.||....:..|:          ::.:|.::.|..|.|.|.:.. |..
Zfish    13 SGQWLTAIILSLCCFLPSCLPAGQTVDYTT----------SSESVVSRQGDTALLRCYLLD-GIS 66

  Fly   148 SVSWIRLRDGHILTVDRAVFIADQRFLAIKQ-PDKY-WTLQIKYVQARDAGSYECQVSTE----P 206
            ..:|  |....|:......:..|.|...:.. .||: ::|||:.|...|.|.|.|.:.:|    |
Zfish    67 KGAW--LNRSSIIYAGNDKWSGDPRVSIVSNVGDKHEYSLQIQKVDVTDEGVYTCSIQSERNLHP 129

  Fly   207 KVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYH-------------- 257
            |:   :||.|.||........|..|..||||.|.|...|..||.  |.|.|              
Zfish   130 KL---IQLIVKVPPKIYDISSDITVNEGSNVSLICAASGKPEPK--ISWRHISPSARKYESGEYL 189

  Fly   258 ---------------GAEQLAADSRRHRTQLDPNLPEA--------------------------- 280
                           |||...|.......::..|.|.|                           
Zfish   190 NITGISRDQAGDYECGAENDIASPDTKTVRVTVNFPPAIHEMKSHGVRPGQVALLRCEAAAVPSP 254

  Fly   281 -----SGEGQSTIG-SLIIESAKKRDT-----------GNYTCSPSN---SPSATVTLNIINGES 325
                 .||.:..:| .::|.:...|..           |||||...|   :.:|:|.||.|...:
Zfish   255 VFEWYKGEKRINMGQGIVINNLSSRSVLTVKNMTQDRYGNYTCVAVNRLGTANASVPLNPIIEPT 319

  Fly   326 SASAVTSSAATTRAY 340
            :.|||:|.|:....|
Zfish   320 TTSAVSSPASNPAMY 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 26/96 (27%)
Ig 127..217 CDD:299845 26/95 (27%)
IG_like 227..320 CDD:214653 35/168 (21%)
IGc2 234..311 CDD:197706 30/152 (20%)
negr1XP_009300786.1 Ig 42..121 CDD:299845 21/91 (23%)
IG_like 44..136 CDD:214653 26/97 (27%)
I-set 140..222 CDD:254352 18/83 (22%)
IGc2 153..208 CDD:197706 14/56 (25%)
IG_like 236..312 CDD:214653 13/75 (17%)
IGc2 238..304 CDD:197706 11/65 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.