DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and negr1

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:340 Identity:80/340 - (23%)
Similarity:116/340 - (34%) Gaps:100/340 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SGDPSSATAFSSLAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNK 147
            ||...:|...|....:.|.||....:..|:          ::.:|.::.|..|.|.|.:.. |..
Zfish    13 SGQWLTAIILSLCCFLPSCLPAGQTVDYTT----------SSESVVSRQGDTALLRCYLLD-GIS 66

  Fly   148 SVSWIRLRDGHILTVDRAVFIADQRFLAIKQ-PDKY-WTLQIKYVQARDAGSYECQVSTE----P 206
            ..:|  |....|:......:..|.|...:.. .||: ::|||:.|...|.|.|.|.:.:|    |
Zfish    67 KGAW--LNRSSIIYAGNDKWSGDPRVSIVSNVGDKHEYSLQIQKVDVTDEGVYTCSIQSERNLHP 129

  Fly   207 KVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYH-------------- 257
            |:   :||.|.||........|..|..||||.|.|...|..||.  |.|.|              
Zfish   130 KL---IQLIVKVPPKIYDISSDITVNEGSNVSLICAASGKPEPK--ISWRHISPSARKYESGEYL 189

  Fly   258 ---------------GAEQLAADSRRHRTQLDPNLPEA--------------------------- 280
                           |||...|.......::..|.|.|                           
Zfish   190 NITGISRDQAGDYECGAENDIASPDTKTVRVTVNFPPAIHEMKSHGVRPGQVALLRCEAAAVPSP 254

  Fly   281 -----SGEGQSTIG-SLIIESAKKRDT-----------GNYTCSPSN---SPSATVTLNIINGES 325
                 .||.:..:| .::|.:...|..           |||||...|   :.:|:|.||.|...:
Zfish   255 VFEWYKGEKRINMGQGIVINNLSSRSVLTVKNMTQDRYGNYTCVAVNRLGTANASVPLNPIIEPT 319

  Fly   326 SASAVTSSAATTRAY 340
            :.|||:|.|:....|
Zfish   320 TTSAVSSPASNPAMY 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 26/96 (27%)
Ig strand B 135..139 CDD:409353 2/3 (67%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 35/168 (21%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 1/3 (33%)
Ig strand E 289..293 CDD:409544 1/4 (25%)
Ig strand G 313..316 CDD:409544 1/2 (50%)
negr1XP_009300786.1 Ig 42..121 CDD:472250 21/91 (23%)
Ig strand B 55..59 CDD:409353 2/3 (67%)
Ig strand C 67..71 CDD:409353 1/5 (20%)
Ig strand E 102..106 CDD:409353 1/3 (33%)
Ig strand F 116..121 CDD:409353 2/4 (50%)
Ig 140..222 CDD:472250 18/83 (22%)
Ig strand B 157..161 CDD:409256 2/3 (67%)
Ig strand C 170..174 CDD:409256 1/5 (20%)
Ig strand E 187..191 CDD:409256 0/3 (0%)
Ig strand F 201..206 CDD:409256 0/4 (0%)
Ig strand G 215..218 CDD:409256 0/2 (0%)
Ig 236..312 CDD:472250 13/75 (17%)
Ig strand B 242..246 CDD:409353 0/3 (0%)
Ig strand C 255..259 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 0/3 (0%)
Ig strand F 294..299 CDD:409353 4/4 (100%)
Ig strand G 307..310 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.