DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and DIP-gamma

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:373 Identity:76/373 - (20%)
Similarity:109/373 - (29%) Gaps:148/373 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 EPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPD 180
            :|...|: .:|||...|..|.|.|.|:.||...|.|:|..|..:|.:...|...:.|...:.|..
  Fly    38 DPEFIGF-INNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDM 101

  Fly   181 KYWTLQIKYVQARDAGSYECQVSTE---------------------------------------- 205
            ..|.|:|..::..|.|.|.||::|.                                        
  Fly   102 HTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKA 166

  Fly   206 -------------------------------------------------------------PKVS 209
                                                                         |.||
  Fly   167 TGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVS 231

  Fly   210 ARVQLQV-----VVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRH 269
            .||.|.|     |...:::||.|     .||:|.|.|.|..:..|.::  |..||......:...
  Fly   232 KRVSLSVQFAPMVRAPSQLLGTP-----LGSDVQLECQVEASPSPVSY--WLKGARTSNGFASVS 289

  Fly   270 RTQLDPNLP-------------EASGEGQSTIGSLIIESAKKRDTGNYTCSPSNS---------- 311
            ...|:...|             ....:|...:..|::.|....|.|.|.|..:||          
  Fly   290 TASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRL 354

  Fly   312 ------PSATVT----LNIING-ESSASAVTSSAATTRAYALSILALL 348
                  |.|:.:    ||.|.| |.:|.....|..||....|::|.||
  Fly   355 YEIKLHPGASASNDDHLNYIGGLEEAARNAGRSNRTTWQPLLAMLMLL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 33/191 (17%)
Ig strand B 135..139 CDD:409353 2/3 (67%)
Ig strand C 148..152 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 2/3 (67%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 25/125 (20%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 0/3 (0%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 1/2 (50%)
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 27/81 (33%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 6/96 (6%)
Ig strand B 160..164 CDD:409562 0/3 (0%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 0/3 (0%)
Ig strand F 217..222 CDD:409562 0/4 (0%)
Ig strand G 231..234 CDD:409562 1/2 (50%)
IG_like 247..355 CDD:214653 24/114 (21%)
Ig strand B 259..263 CDD:409358 2/3 (67%)
Ig strand C 272..276 CDD:409358 0/5 (0%)
Ig strand E 317..326 CDD:409358 2/8 (25%)
Ig strand F 336..341 CDD:409358 2/4 (50%)

Return to query results.
Submit another query.