DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and klg

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster


Alignment Length:324 Identity:83/324 - (25%)
Similarity:125/324 - (38%) Gaps:91/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GILCLTIASHTQTSAEAAGGRVSGP-------------------GAGTSEGAGTSSASAASTAIS 79
            |.|...|.:|...:|.|:|.|.|..                   |......|| |...|...|||
  Fly    11 GALAPPITAHASANANASGLRKSSQRRNRAPLQMNCPILIVISLGWLLHAHAG-SGGFAVEAAIS 74

  Fly    80 SDESGDPSSATAFSSLAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQ--IGTHAYLPCRVK 142
            :..|..       .|::.|......||.|:||       |..:.:...|.:  :|....|||:|:
  Fly    75 NRGSNS-------RSMSNVQQSAVAASTLTAT-------LPRFLSRGHTYRAVVGDTLVLPCQVE 125

  Fly   143 QLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPK 207
            .|||..:.|  .|..::||....:...|:|   ::..|.| .|:|..::.:|||.|.||:|  .|
  Fly   126 NLGNFVLLW--RRGTNVLTASNIMVTRDER---VRLIDGY-NLEISDLEPQDAGDYVCQIS--DK 182

  Fly   208 VSARVQLQVVVPRTEILGEPDRYVKA-----------GSNVVLRCIVRGALEPPTFIMWYHGAEQ 261
            :: |.|:..|    |||..|.  |:|           |..:.|.|  :|:..|...|.|      
  Fly   183 IN-RDQVHTV----EILVPPS--VRAIPTSGQLQARKGGPITLEC--KGSGNPVPSIYW------ 232

  Fly   262 LAADSRRHRTQLDPNLPEASGEGQST--IGS---LIIESAKKRDTGNYTCSPSNSPSATVTLNI 320
                            .:.||..:||  ||.   |.:|..:::..|.|.|:..|.....||:::
  Fly   233 ----------------TKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 29/92 (32%)
Ig 127..217 CDD:299845 29/91 (32%)
IG_like 227..320 CDD:214653 24/108 (22%)
IGc2 234..311 CDD:197706 18/81 (22%)
klgNP_524454.2 DUF1370 63..>124 CDD:284518 20/75 (27%)
IG_like 109..195 CDD:214653 32/98 (33%)
Ig 118..191 CDD:143165 27/81 (33%)
IG_like 205..274 CDD:214653 19/92 (21%)
IGc2 213..273 CDD:197706 19/83 (23%)
IGc2 301..367 CDD:197706
FN3 392..486 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.