DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Ama

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:217 Identity:56/217 - (25%)
Similarity:90/217 - (41%) Gaps:32/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRL-----RDGHILTVDRAV 166
            |:|..|.|..|.: ...:.:|...:|......|.|:::|..||||.:.     .:..:|::...:
  Fly    23 AISLDSVLSAPVI-SQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNIL 86

  Fly   167 FIADQRF-LAIKQPDK----YWTLQIKYVQARDAGSYECQ--VSTEPKVSARVQLQVVVPRTEIL 224
            .:.|||: :.:.:..|    .:|.:|:.::..|.|.||||  ||...||:.::.||:..|.....
  Fly    87 SLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAE 151

  Fly   225 GEP-DRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTI 288
            ..| ...|..|.|:.|.|...|..:|.  |.|          :|.|      |....:|......
  Fly   152 NTPKSTLVTEGQNLELTCHANGFPKPT--ISW----------AREH------NAVMPAGGHLLAE 198

  Fly   289 GSLIIESAKKRDTGNYTCSPSN 310
            .:|.|.|..:.|.|.|.|...|
  Fly   199 PTLRIRSVHRMDRGGYYCIAQN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 27/102 (26%)
Ig 127..217 CDD:299845 28/101 (28%)
IG_like 227..320 CDD:214653 22/85 (26%)
IGc2 234..311 CDD:197706 20/77 (26%)
AmaNP_731114.2 I-set 33..143 CDD:254352 28/110 (25%)
Ig 37..127 CDD:299845 21/89 (24%)
IG_like 154..234 CDD:214653 22/85 (26%)
IGc2 161..223 CDD:197706 20/78 (26%)
I-set 254..330 CDD:254352
IGc2 254..322 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.