DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and kirrel1a

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001349348.1 Gene:kirrel1a / 405804 ZFINID:ZDB-GENE-040426-2126 Length:819 Species:Danio rerio


Alignment Length:237 Identity:58/237 - (24%)
Similarity:90/237 - (37%) Gaps:57/237 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 AQVSSLLPEASALSAT----SGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRD 156
            |..|.:|.:...||..    ||:|:...||.|..                  :|....:|.|.|.
Zfish    27 ADQSVVLGQRVVLSCVVFNYSGIVQWTKDGLALG------------------IGEDLRAWPRYRV 73

  Fly   157 GHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRT 221
            ..::.|.:                  :.|:|...:..|...||||.:.....|.|.:|.|::|..
Zfish    74 LRLVDVGQ------------------YNLEISAAELSDDSLYECQATEAALRSRRAKLTVLIPPD 120

  Fly   222 E--ILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEG 284
            |  |.|.|:..:.||....:.|:.||| :|.:.|.|.  .:.|..:.....|::.|:....:...
Zfish   121 EPVIEGSPEILLTAGVPYNMSCVSRGA-KPASVIEWQ--KDGLPIEGAVSTTEVLPDRKRVTTRS 182

  Fly   285 QSTIGSLIIESAKKRDTG-NYTCSPSN-----SPSATVTLNI 320
            ...|..|      ..||| |:||..:|     ...||:|||:
Zfish   183 YLPIQPL------DTDTGKNFTCVATNLAVPMGKRATITLNV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 15/90 (17%)
Ig 127..217 CDD:299845 15/89 (17%)
IG_like 227..320 CDD:214653 26/98 (27%)
IGc2 234..311 CDD:197706 20/82 (24%)
kirrel1aNP_001349348.1 I-set 21..115 CDD:333254 26/123 (21%)
Ig2_KIRREL3-like 137..218 CDD:143236 23/89 (26%)
I-set 222..303 CDD:333254
Ig_3 307..372 CDD:316449
Ig5_KIRREL3 390..493 CDD:143306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.