DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and LSAMP

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:264 Identity:79/264 - (29%)
Similarity:107/264 - (40%) Gaps:45/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LAQVSSLLPEASALSATSGLVEPYLD-GYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGH 158
            |.::..|||        :||....:| ...|.|:|.:.|..|.|.|.|:. .|..|:|:. |.| 
Human    16 LLRLLCLLP--------TGLPVRSVDFNRGTDNITVRQGDTAILRCVVED-KNSKVAWLN-RSG- 69

  Fly   159 ILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVST--EPKVSARVQLQVVVPRT 221
            |:......:..|.|....|:....::|:|:.|...|.|||.|.|.|  |||.| :|.|.|.||..
Human    70 IIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTS-QVYLIVQVPPK 133

  Fly   222 EILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQS 286
            ......|..|..||||.|.|:..|..||  .|.|.|               |.|...|..||.: 
Human   134 ISNISSDVTVNEGSNVTLVCMANGRPEP--VITWRH---------------LTPTGREFEGEEE- 180

  Fly   287 TIGSLIIESAKKRDTGNYTCSPSNSPSAT------VTLN---IINGESSASAVTSSAATTRAYAL 342
               .|.|....:..:|.|.|..:|..|:.      ||:|   .|....|..|.|...|:.:..|.
Human   181 ---YLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEAS 242

  Fly   343 SILA 346
            ::.|
Human   243 AVPA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 32/92 (35%)
Ig 127..217 CDD:299845 31/91 (34%)
IG_like 227..320 CDD:214653 29/101 (29%)
IGc2 234..311 CDD:197706 22/76 (29%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 33/93 (35%)
Ig 132..215 CDD:386229 27/103 (26%)
Ig_3 219..294 CDD:372822 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.