DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and CG7166

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:199 Identity:52/199 - (26%)
Similarity:79/199 - (39%) Gaps:42/199 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 IGTHAYLPCRVKQLGNKSVSWIRLRDG-HILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARD 194
            :|....|||:|:.||:..:.|   |.| .:||........||||..:..    :.|||..|:.:|
  Fly    52 VGETIELPCKVQNLGSFVLLW---RKGSSVLTAGHLKITRDQRFKIVGD----YNLQINGVKTQD 109

  Fly   195 AGSYECQVSTEPKVSARVQLQVVVPRTEILGEPDR---YVKAGSNVVLRCIVRGALEPPTFIMW- 255
            ||.|.||:..:........::::||.| :...|..   ..:.||.|.|.|...|  .|...|.| 
  Fly   110 AGDYICQLGDQENRDQVHTVEILV
PPT-LRALPHNGQVTARKGSTVTLECKASG--NPVPTIFWF 171

  Fly   256 ----YHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATV 316
                :.|...|:..|                       :||:|:..:...|.|.||..|.....|
  Fly   172 KKDVFSGPTHLSDSS-----------------------TLILENVDRHHAGTYQCSADNGVKDRV 213

  Fly   317 TLNI 320
            :::|
  Fly   214 SMDI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 26/85 (31%)
Ig 127..217 CDD:299845 26/86 (30%)
IG_like 227..320 CDD:214653 22/100 (22%)
IGc2 234..311 CDD:197706 19/81 (23%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 26/87 (30%)
Ig 56..116 CDD:143165 23/66 (35%)
IG_like 144..221 CDD:214653 22/99 (22%)
IGc2 151..209 CDD:197706 20/82 (24%)
IG_like 232..313 CDD:214653
Ig 242..311 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.