DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and dpr13

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:404 Identity:127/404 - (31%)
Similarity:179/404 - (44%) Gaps:98/404 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLGGILCLTIASHTQTSAEAAGGRVSGPGAGTSEGAGTSSASAAST-------AISSDESGDP-- 86
            ::..|....|..|| .||...||:       |.....|:.||..|.       .:|..:.|:|  
  Fly    28 IIAYIAACGICDHT-ASASPGGGK-------TVAATMTTPASEPSVRHINQNLIMSQSKEGEPVP 84

  Fly    87 --------------SSATAFSSLAQVS-------SLLPEA-------SALSA--TSG-------- 113
                          ||.|:|.|...:.       :.|.||       |.:.|  |:|        
  Fly    85 VPQPYAQSAASAGGSSITSFDSTNVIDGQSQPTPTHLQEAVLQTHSHSRIQAKDTAGPYPIPVHR 149

  Fly   114 --LVEPYLDG-----------------YATSN---VTTQIGTHAYLPCRVKQLGNKSVSWIRLRD 156
              .||.:|:.                 :.|.|   ||||||..|::||.|..:|...|||||.:|
  Fly   150 PEPVENHLEANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKD 214

  Fly   157 GHILTVDRAVFIADQRFLA--IKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVP 219
            .|:|||....:.:|:||.|  :|..:. ||||||:||.||||.|||||||.|..|..:.|.||..
  Fly   215 YHLLTVGLTTYSSDERFSATHLKHSED-WTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEA 278

  Fly   220 RTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEG 284
            |.||.|.|.||:..||.:.|:|.|....|...:|.|||       |:|.....:|..: ..|.|.
  Fly   279 RAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYH-------DNRMINYDIDRGI-NVSTEP 335

  Fly   285 QSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSASA----VTSSAATTRAYALSIL 345
            ......|.|:..::..:||:||..||:..|:|.::|..|::.|:.    |..|..||::      
  Fly   336 DFQSSELTIQRTRREHSGNFTCVASNTQPASVLVHIFKGDNPAAMYHGHVGGSTKTTQS------ 394

  Fly   346 ALLLSVILIGVGHR 359
            .|.:.:|:|..|:|
  Fly   395 QLHMIMIIIASGYR 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 49/95 (52%)
Ig 127..217 CDD:299845 48/91 (53%)
IG_like 227..320 CDD:214653 28/92 (30%)
IGc2 234..311 CDD:197706 22/76 (29%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 49/96 (51%)
IG_like 182..262 CDD:214653 42/80 (53%)
IG_like 285..362 CDD:214653 25/84 (30%)
IGc2 292..361 CDD:197706 21/76 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.