DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and ImpL2

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:183 Identity:42/183 - (22%)
Similarity:60/183 - (32%) Gaps:45/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 IRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVST--EPKVSARVQL 214
            :|:|..||  :|..  :::.|               .|......||.....||  .|..|:|:..
  Fly   119 VRVRSSHI--IDHV--LSEAR---------------TYTCVGRTGSKTIYASTVVHPPRSSRLTP 164

  Fly   215 QVVVPRTE----ILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDP 275
            :...|..:    |..|.......|||:.|.|.|..  .|...|.|.:...:......|||...: 
  Fly   165 EKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHA--RPRAEITWLNNENKEIVQGHRHRVLAN- 226

  Fly   276 NLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSN----SPSATVTLNIINGE 324
                         |.|:|...|..|.|||.|...|    ..:.|....::|.|
  Fly   227 -------------GDLLISEIKWEDMGNYKCIARNVVGKDTADTFVYPVLNEE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 14/65 (22%)
Ig 127..217 CDD:299845 14/66 (21%)
IG_like 227..320 CDD:214653 23/96 (24%)
IGc2 234..311 CDD:197706 22/80 (28%)
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.