DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Gm1123

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001074245.1 Gene:Gm1123 / 382097 MGIID:2685969 Length:390 Species:Mus musculus


Alignment Length:338 Identity:81/338 - (23%)
Similarity:118/338 - (34%) Gaps:107/338 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GRVSGPGAGTSEGAGTSSASAASTAISSDESGD--------PSSA------TAFSSLAQVSSLLP 103
            |||:    .||.|..:..||.....:...:||.        |..|      |....:..||...|
Mouse    90 GRVN----FTSNGITSGEASIKIRDVQPADSGTYLCKVKTAPGVAKTTVQLTVVDYIGSVSITTP 150

  Fly   104 EASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRV----KQLGNKSVSWIRLRDGHILTVDR 164
            |                    ..:....|...:|||..    |..|..::.|:||...:...:|.
Mouse   151 E--------------------QTIEKDQGETVHLPCMFTFISKDQGPLNIEWLRLSGPNNEAMDH 195

  Fly   165 AVFI--ADQ-------------RFLA--IKQPDKYWTLQIKYVQARDAGSYECQVSTEP-KVSAR 211
            .|.:  ||:             .|.:  ||..|.  ::.|..||..|||:|:|:|.|.| .|:..
Mouse   196 VVILYSADKIHDDVYPDLKGRVYFTSNDIKSGDA--SINITNVQLSDAGTYQCKVKTYPGTVNRN 258

  Fly   212 VQLQVVVPRTEILGE-----PDRYVK--AGSNVVLRCIVRGALEP----PTFIMWYH--GAEQ-- 261
            :||.|    |:.:|.     |::.::  .|..|.|.|..  .|.|    |.||.|..  |.:.  
Mouse   259 LQLAV----TDHIGSVSITTPEQTIQKARGETVHLPCTF--TLSPEDHGPLFIDWMQLTGPQNEV 317

  Fly   262 -------LAAD--------SRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSN- 310
                   ..||        ..:.|.|...| ...|||     .|:.|..|:..|.|.|.|..|: 
Mouse   318 VNRMFIVYLADKIYDNFYQDMKGRVQFTSN-DIRSGE-----ASINITDARLSDAGTYQCGVSHA 376

  Fly   311 --SPSATVTLNII 321
              :...|:.|.::
Mouse   377 FGTAKGTIQLTVV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 31/112 (28%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 0/3 (0%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 30/120 (25%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 2/3 (67%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
Gm1123NP_001074245.1 Ig 20..137 CDD:472250 12/50 (24%)
Ig strand B 37..41 CDD:409353
Ig strand C 54..58 CDD:409353
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 0/4 (0%)
Ig strand G 131..134 CDD:409353 0/2 (0%)
Ig 145..261 CDD:472250 33/137 (24%)
Ig strand B 162..166 CDD:409353 1/3 (33%)
Ig strand C 179..183 CDD:409353 0/3 (0%)
Ig strand E 229..233 CDD:409353 0/5 (0%)
Ig strand F 243..248 CDD:409353 2/4 (50%)
Ig strand G 256..259 CDD:409353 0/2 (0%)
Ig 270..387 CDD:472250 29/124 (23%)
Ig strand B 287..291 CDD:409353 2/3 (67%)
Ig strand C 304..308 CDD:409353 2/3 (67%)
Ig strand E 354..358 CDD:409353 1/3 (33%)
Ig strand F 368..373 CDD:409353 2/4 (50%)
Ig strand G 381..384 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.