DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and dpr20

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:353 Identity:95/353 - (26%)
Similarity:156/353 - (44%) Gaps:51/353 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ASHTQTSAEAAGGRVSGPGAGTSEGAGTSSASAASTAISSDESGDPSSATAFSSLAQVSSLLPEA 105
            ||..|..::.....|....|.||  :|..|:|.||.|..::.:.:.|:....:|..:|.|..|.:
  Fly   171 ASFQQIGSQNVNALVPATVATTS--SGLPSSSNASLATPTEPARNRSTGLVRNSAVKVDSKHPLS 233

  Fly   106 SALSATSGLVEPYLDGYAT------------------------SNVTTQIGTHAYLPCRVKQLGN 146
            ......:.::....|.:::                        :|:|.|.|:..:|.||:..|.:
  Fly   234 KGQKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQD 298

  Fly   147 KSVSWIRLR-------DGH---ILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQ 201
            |:|||:|..       :|:   :|||....:..|:|:....|....|.|:|..|:..|...||||
  Fly   299 KTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQ 363

  Fly   202 VSTEPKVSARVQLQVVVPRTEI---LGEP--DRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQ 261
            :||.|....::.|.|..|:..|   :|:|  ::|.:..|.:.|.|:||......:.:.|.|....
  Fly   364 ISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNI 428

  Fly   262 LAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESS 326
            |..|..|....:...|.|   :|.::  :|.|....|.|:||||||.|...:.|:.::|:||||.
  Fly   429 LNYDVTRGGVSVKTELME---DGANS--TLSIAKISKTDSGNYTCSISEFQNFTIVVHILNGESF 488

  Fly   327 A-----SAVTSSAATTRAYALSILALLL 349
            |     .||...:.......|..:|||:
  Fly   489 AELHHGGAVGWHSTWWNMVMLHAMALLV 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 33/100 (33%)
Ig 127..217 CDD:299845 32/99 (32%)
IG_like 227..320 CDD:214653 27/94 (29%)
IGc2 234..311 CDD:197706 24/76 (32%)
dpr20NP_612066.1 IG_like 278..365 CDD:214653 29/86 (34%)
Ig 279..378 CDD:299845 32/98 (33%)
Ig 400..471 CDD:299845 23/75 (31%)
IG_like 402..480 CDD:214653 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444683
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.