DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and wrapper

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:250 Identity:65/250 - (26%)
Similarity:99/250 - (39%) Gaps:50/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ISSDESGDPSSATAFSSLAQVSSLLPEASALS---ATSGLVEPYLDGYATSNVTTQ-IGTHAYLP 138
            :.|.::||     .:..:...|..:.:..|:.   |...|:||       |::|.| ||....:.
  Fly   101 VQSSDTGD-----YYCEMNSDSGHVVQQHAIEVQLAPQVLIEP-------SDLTEQRIGAIFEVV 153

  Fly   139 CRVKQLGNKSVSWIRLRDGHIL-----TVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSY 198
            |..:.:....::| || :|:::     |.:|...|                |:||  ....||..
  Fly   154 CEAQGVPQPVITW-RL-NGNVIQPQSNTGNRQSLI----------------LEIK--SRNQAGLI 198

  Fly   199 ECQVST---EPKVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGA- 259
            ||..|.   ||.| |.|.|.|:......:.:|..|.|.||...|.|||..|  |...:.|:|.. 
  Fly   199 ECVASNGVGEPAV-ANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAA--PAATVKWFHHGL 260

  Fly   260 -EQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPS 313
             ..|.|.|..|.::|..| ........:....|:::|.:..|.|.|.|..||..|
  Fly   261 PVALGAHSTTHESELQTN-RSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQIS 314

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 27/99 (27%)
Ig strand B 135..139 CDD:409353 0/3 (0%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 27/88 (31%)
Ig strand B 237..241 CDD:409544 1/3 (33%)
Ig strand C 252..256 CDD:409544 0/3 (0%)
Ig strand E 289..293 CDD:409544 1/3 (33%)