DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and nitr1h

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001011884.1 Gene:nitr1h / 368781 ZFINID:ZDB-GENE-041001-84 Length:339 Species:Danio rerio


Alignment Length:181 Identity:44/181 - (24%)
Similarity:73/181 - (40%) Gaps:33/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 VKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVST- 204
            |...|::..||            ...|....||:|.| .|.::.|.|......|:.:|.|.||: 
Zfish    80 VSLYGSQKPSW------------NPKFENKNRFIAAK-GDNFFNLTILKTTLSDSATYYCVVSSY 131

  Fly   205 -EPKVSARVQLQV---VVPRTEILGEP--DRYVKAGSNVVLRC-IVRGALEPPTFIMWYHGAEQL 262
             ...:.:..:|.|   |..|...|.:.  |. |.:|.:|.|:| |...:......:.|:   :|:
Zfish   132 QATGMGSGTRLLVR
DAVADRKRTLHQSLIDN-VDSGDSVYLQCSIFTESCAGDHSVYWF---KQI 192

  Fly   263 AADS------RRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCS 307
            :.||      :..|.....|..|:  :.||.:.||...:..:.|:|.|.|:
Zfish   193 SGDSEGVLYTKGERNGRCKNSTES--QTQSCVYSLHKNNISRSDSGIYYCA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 18/76 (24%)
Ig 127..217 CDD:299845 19/80 (24%)
IG_like 227..320 CDD:214653 22/90 (24%)
IGc2 234..311 CDD:197706 20/81 (25%)
nitr1hNP_001011884.1 V-set 45..145 CDD:284989 18/77 (23%)
IG_like 45..144 CDD:214653 18/76 (24%)
IG_like 163..242 CDD:214653 21/84 (25%)
V-set 166..258 CDD:284989 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.