DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Cadm4

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001040572.1 Gene:Cadm4 / 365216 RGDID:1304722 Length:388 Species:Rattus norvegicus


Alignment Length:372 Identity:78/372 - (20%)
Similarity:115/372 - (30%) Gaps:156/372 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVD-- 163
            ||..|:|...|:..|:       |.|||...|..|.:.||:.|.           ||.|:.:.  
  Rat    13 LLWAAAAGPGTAQEVQ-------TENVTVAEGGVAEITCRLHQY-----------DGSIVVIQNP 59

  Fly   164 --RAVF------IADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTE--------------- 205
              :.:|      :.|:||...:...:...:::...:..|.|.|.||:.||               
  Rat    60 ARQTLFFNGTRALKDERFQLEEFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVAP 124

  Fly   206 --PKVSAR--------VQLQVVVPRT-------------EILG-------------------EPD 228
              |.|..|        |:|..:|||:             |:.|                   ..|
  Rat   125 ENPVVEVREQAVEGGEVELSCLVPRSRPAAVLRWYRDRKELKGVSSGQENGKVWSVASTVRFRVD 189

  Fly   229 R-------------------------------------------YVKAGSNVVLRCIVRGALEP- 249
            |                                           .|:.|..:||.|.|.|  .| 
  Rat   190 RKDDGGIVICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTG--NPR 252

  Fly   250 PTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSA 314
            |..|.|..|.|.|            |...||.||      :|.:......|.|.|||..:|....
  Rat   253 PNQIRWNRGNESL------------PERAEALGE------TLTLPGLVSADNGTYTCEAANKHGH 299

  Fly   315 TVTLNIINGESSASAVTSSAATTRAYA-----LSILALLLSVILIGV 356
            ...|.::......:.|  .|.|:..||     |::|..|:..:|:|:
  Rat   300 ARALYVLVVYDPGAVV--EAQTSVPYAIVGGILALLVFLIICVLVGM 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 27/125 (22%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 0/3 (0%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 29/136 (21%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 1/3 (33%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
Cadm4NP_001040572.1 Ig 29..120 CDD:472250 23/101 (23%)
Ig strand B 40..44 CDD:409465 1/3 (33%)
Ig strand C 53..57 CDD:409465 1/3 (33%)
Ig strand E 87..91 CDD:409465 0/3 (0%)
Ig strand F 101..106 CDD:409465 2/4 (50%)
Ig strand G 113..116 CDD:409465 0/2 (0%)
IgI_2_Necl-4 121..220 CDD:409468 12/98 (12%)
Ig strand A 121..124 CDD:409468 0/2 (0%)
Ig strand A' 127..131 CDD:409468 2/3 (67%)
Ig strand B 139..149 CDD:409468 3/9 (33%)
Ig strand C 152..161 CDD:409468 0/8 (0%)
Ig strand C' 162..165 CDD:409468 0/2 (0%)
Ig strand D 167..174 CDD:409468 1/6 (17%)
Ig strand E 177..187 CDD:409468 0/9 (0%)
Ig strand F 195..203 CDD:409468 0/7 (0%)
Ig strand G 212..219 CDD:409468 0/6 (0%)
Ig_3 224..295 CDD:464046 25/90 (28%)
4.1m 344..362 CDD:128590 0/1 (0%)

Return to query results.
Submit another query.