DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Lac

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:206 Identity:64/206 - (31%)
Similarity:84/206 - (40%) Gaps:27/206 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 YATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRL-RDGHILTVDRAVFIADQRFLAIKQPD-KYWT 184
            |.|......||......|.|:.....:|.:::. .|...|:....:.|.|.||.....|: ..:.
  Fly    33 YITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYK 97

  Fly   185 LQIKYVQARDAGSYECQV--STEPKVSARVQLQVVVPRTEILGEPDRYVKA--GSNVVLRCIVRG 245
            ||||.:|..|||:|.|||  ||..||||.|:|.|..|.. |.....:.|.|  ||.|.:.|...|
  Fly    98 LQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPV-ISDNSTQSVVASEGSEVQMECYASG 161

  Fly   246 ALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIG-SLIIESAKKRDTGNYTCSPS 309
              .|...|.|           ||....:.|.      :..:.:| :|.|:|.||.|.|.|.|...
  Fly   162 --YPTPTITW-----------RRENNAILPT------DSATYVGNTLRIKSVKKEDRGTYYCVAD 207

  Fly   310 NSPSATVTLNI 320
            |..|.....||
  Fly   208 NGVSKGDRRNI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 32/94 (34%)
Ig strand B 135..139 CDD:409353 0/3 (0%)
Ig strand C 148..152 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 25/95 (26%)
Ig strand B 237..241 CDD:409544 1/3 (33%)
Ig strand C 252..256 CDD:409544 1/3 (33%)
Ig strand E 289..293 CDD:409544 2/4 (50%)
Ig strand G 313..316 CDD:409544 1/2 (50%)
LacNP_523713.2 IG_like 36..131 CDD:214653 32/94 (34%)
Ig strand B 46..50 CDD:409381 0/3 (0%)
Ig strand C 60..63 CDD:409381 1/2 (50%)
Ig strand E 96..100 CDD:409381 1/3 (33%)
Ig strand F 110..115 CDD:409381 2/4 (50%)
Ig strand G 124..127 CDD:409381 2/2 (100%)
Ig_3 134..208 CDD:464046 25/93 (27%)
Ig 227..318 CDD:472250
Ig strand C 256..260 CDD:409353
Ig strand E 286..290 CDD:409353
Ig strand F 300..305 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.