DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and DIP-zeta

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:319 Identity:89/319 - (27%)
Similarity:125/319 - (39%) Gaps:49/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLGGILCLTIASHTQTS----AEAAGGRVSGPGAGTSEGAGTSSASAASTAI---------SSDE 82
            |:|.:|.|...:...|:    .:...|...|.|.||::|...|.:...:|.:         :...
  Fly     8 LIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPSGSKTVATGVVPNFGGAAGNGAG 72

  Fly    83 SGDP--SSATAFSSLAQVSSLLPEASALSATSGL----VEPYLDGYATSNVTTQIGTHAYLPCRV 141
            .|.|  .|.|..:.:.....::....|...||.|    .||....| ..|||...|.:..|.|.|
  Fly    73 GGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEY-IENVTVPAGRNVKLGCSV 136

  Fly   142 KQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKY-----WTLQIKYVQARDAGSYECQ 201
            |.||:..|:|:......||||...|...:.|.....  ||:     |.|.|..|...|.|.|.||
  Fly   137 KNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTH--DKHDRHRTWYLHINNVHEEDRGRYMCQ 199

  Fly   202 VSTEPKVSARVQ---LQVVVPRT--EILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQ 261
            ::|   |:|:.|   |.||||..  :.|...|..|:.|:|:.|||...|:  |...|.|......
  Fly   200 INT---VTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGS--PRPIIKWKRDDNS 259

  Fly   262 LAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNI 320
            ..|.::.|...      |..|:      :|.|....:.|.|.|.|..||....||:..|
  Fly   260 RIAINKNHIVN------EWEGD------TLEITRISRLDMGAYLCIASNGVPPTVSKRI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 34/98 (35%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 2/3 (67%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 25/92 (27%)
Ig strand B 237..241 CDD:409544 1/3 (33%)
Ig strand C 252..256 CDD:409544 1/3 (33%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 35/100 (35%)
Ig strand B 130..134 CDD:409405 1/3 (33%)
Ig strand C 143..147 CDD:409405 1/3 (33%)
Ig strand E 178..185 CDD:409405 2/6 (33%)
IgI_1_MuSK 218..310 CDD:409562 27/103 (26%)
Ig strand A 218..221 CDD:409562 0/2 (0%)
Ig strand A' 226..231 CDD:409562 1/4 (25%)
Ig strand B 237..244 CDD:409562 3/6 (50%)
Ig strand C 250..255 CDD:409562 2/4 (50%)
Ig strand C' 257..259 CDD:409562 0/1 (0%)
Ig strand D 267..270 CDD:409562 1/2 (50%)
Ig strand E 275..281 CDD:409562 2/11 (18%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 2/5 (40%)
IG_like 325..410 CDD:214653
Ig strand B 331..335 CDD:143207
Ig strand C 344..348 CDD:143207
Ig strand E 376..380 CDD:143207
Ig strand F 390..395 CDD:143207
Ig strand G 403..406 CDD:143207
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.