DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and DIP-zeta

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:319 Identity:89/319 - (27%)
Similarity:125/319 - (39%) Gaps:49/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLGGILCLTIASHTQTS----AEAAGGRVSGPGAGTSEGAGTSSASAASTAI---------SSDE 82
            |:|.:|.|...:...|:    .:...|...|.|.||::|...|.:...:|.:         :...
  Fly     8 LIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPSGSKTVATGVVPNFGGAAGNGAG 72

  Fly    83 SGDP--SSATAFSSLAQVSSLLPEASALSATSGL----VEPYLDGYATSNVTTQIGTHAYLPCRV 141
            .|.|  .|.|..:.:.....::....|...||.|    .||....| ..|||...|.:..|.|.|
  Fly    73 GGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEY-IENVTVPAGRNVKLGCSV 136

  Fly   142 KQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKY-----WTLQIKYVQARDAGSYECQ 201
            |.||:..|:|:......||||...|...:.|.....  ||:     |.|.|..|...|.|.|.||
  Fly   137 KNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTH--DKHDRHRTWYLHINNVHEEDRGRYMCQ 199

  Fly   202 VSTEPKVSARVQ---LQVVVPRT--EILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQ 261
            ::|   |:|:.|   |.||||..  :.|...|..|:.|:|:.|||...|:  |...|.|......
  Fly   200 INT---VTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGS--PRPIIKWKRDDNS 259

  Fly   262 LAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNI 320
            ..|.::.|...      |..|:      :|.|....:.|.|.|.|..||....||:..|
  Fly   260 RIAINKNHIVN------EWEGD------TLEITRISRLDMGAYLCIASNGVPPTVSKRI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 34/98 (35%)
Ig 127..217 CDD:299845 33/97 (34%)
IG_like 227..320 CDD:214653 25/92 (27%)
IGc2 234..311 CDD:197706 20/76 (26%)
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 35/100 (35%)
Ig 130..200 CDD:143165 24/71 (34%)
I-set 226..310 CDD:254352 26/95 (27%)
IGc2 233..298 CDD:197706 21/78 (27%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.