DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and DIP-iota

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:255 Identity:68/255 - (26%)
Similarity:97/255 - (38%) Gaps:48/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 EPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPD 180
            :|...| ..:|.|..:|..|.|.|.|..|.:..|:|:|:....||::...|...:.|........
  Fly    30 DPKFSG-PINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEH 93

  Fly   181 KYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPR--TEILGEPDRYVKAGSNVVLRCIV 243
            :.|.|:|:.||..|.|.|.||::|:|..|....|.||||.  .:.....|.....|.||.|.|..
  Fly    94 RIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSA 158

  Fly   244 RGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASG-------EGQSTIGSLIIESAKKRDT 301
            .|.  |...|.|             .|.:..|.|....|       |||    :|.:...::...
  Fly   159 TGV--PMPTITW-------------RREEATPILISDDGDREVFSVEGQ----NLTLWQVQRSHM 204

  Fly   302 GNYTCSPSNSPSATVTLNIINGESSASAVTSSAAT--TRAYALSILALLLSVILIGVGHR 359
            |.|.|..||....||:..::       .|.:.|.|  ||          ...|.:|:|.:
  Fly   205 GAYLCIASNGVPPTVSKRVM-------LVVNFAPTIWTR----------YDTIYVGLGQK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 29/90 (32%)
Ig strand B 135..139 CDD:409353 2/3 (67%)
Ig strand C 148..152 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 2/3 (67%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 25/99 (25%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 1/3 (33%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 28/85 (33%)
Ig strand B 48..52 CDD:143290 2/3 (67%)
Ig strand C 61..65 CDD:143290 1/3 (33%)
Ig strand E 96..100 CDD:143290 2/3 (67%)
Ig strand F 110..115 CDD:143290 2/4 (50%)
Ig 133..227 CDD:472250 25/119 (21%)
Ig strand B 152..156 CDD:409562 2/3 (67%)
Ig strand C 165..169 CDD:409562 2/16 (13%)
Ig strand E 192..196 CDD:409562 2/7 (29%)
Ig strand F 206..211 CDD:409562 2/4 (50%)
Ig strand G 220..223 CDD:409562 0/2 (0%)
Ig_3 231..310 CDD:464046 6/27 (22%)

Return to query results.
Submit another query.