DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and DIP-eta

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:239 Identity:76/239 - (31%)
Similarity:107/239 - (44%) Gaps:38/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 NVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYV 190
            |:|..:|..|:|.|.|:.||...|:|:|:....|||:...|...:||........|.||::||.:
  Fly    51 NMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDI 115

  Fly   191 QARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEP---DRYVKAGSNVVLRCIVRGALEPPTF 252
            :..|.|.|.||::|:|..|....|.|||| .:||..|   |..|:.||||.|:|...|:.||.  
  Fly   116 KESDKGWYMCQINTDPMKSQMGYLDVVVP-PDILDYPTSTDMVVREGSNVTLKCAATGSPEPT-- 177

  Fly   253 IMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTI--GSLIIESAKKRDTGNYTCSPSN----S 311
            |.|              |.:....:..|:||...:|  ..|:|.:.::...|.|.|..||    |
  Fly   178 ITW--------------RRESGVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPS 228

  Fly   312 PSATVTL-----------NIINGESSASAVTSSAATTRAYALSI 344
            .|..:||           |.:.|......||.. ..:.||..||
  Fly   229 VSKRITLVVHFPPMITVQNQLIGAVEGKGVTLD-CESEAYPKSI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 32/89 (36%)
Ig 127..217 CDD:299845 31/89 (35%)
IG_like 227..320 CDD:214653 30/112 (27%)
IGc2 234..311 CDD:197706 23/82 (28%)
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 32/89 (36%)
IG_like 51..137 CDD:214653 31/85 (36%)
IG_like 153..237 CDD:214653 29/99 (29%)
Ig 161..224 CDD:299845 22/78 (28%)
IG_like 252..335 CDD:214653 6/21 (29%)
Ig 258..333 CDD:143165 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.