DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and fipi

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:211 Identity:48/211 - (22%)
Similarity:75/211 - (35%) Gaps:33/211 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 VTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQ 191
            :|.:.|..|.:.|.||.....:|:|  ..:|..::...|   .|.:|..:..     .|.|..|.
  Fly   128 MTVKEGEKATILCEVKGEPQPNVTW--HFNGQPISAGAA---DDSKFRILAD-----GLLINKVT 182

  Fly   192 ARDAGSYECQVSTEPKVSARVQLQVVVPRTE---ILGEPD----RYVKAGSNVVLRCIVRGALEP 249
            ..|.|.|.|:......:::.:|.:.|:.:.|   |..:..    :|........|.|  ....||
  Fly   183 QNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMC--EALAEP 245

  Fly   250 PTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSA 314
            |....||....:|.:::|.:..|.|           |...||.|.........||.|...|. ..
  Fly   246 PANFTWYRKHNKLHSNNRLYTIQSD-----------SYWSSLTIHVLNTSAFDNYRCRARND-LG 298

  Fly   315 TV--TLNIINGESSAS 328
            |:  |..:..||...|
  Fly   299 TIERTTRLEQGEKPPS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 20/88 (23%)
Ig 127..217 CDD:299845 20/89 (22%)
IG_like 227..320 CDD:214653 22/98 (22%)
IGc2 234..311 CDD:197706 18/76 (24%)
fipiNP_787975.1 IG_like 33..115 CDD:214653
I-set 128..202 CDD:254352 19/83 (23%)
Ig 133..>193 CDD:299845 18/69 (26%)
IG_like 228..307 CDD:214653 22/92 (24%)
Ig 235..305 CDD:143165 21/83 (25%)
FN3 312..415 CDD:238020 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.