Sequence 1: | NP_001262320.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_787975.1 | Gene: | fipi / 33676 | FlyBaseID: | FBgn0031627 | Length: | 450 | Species: | Drosophila melanogaster |
Alignment Length: | 211 | Identity: | 48/211 - (22%) |
---|---|---|---|
Similarity: | 75/211 - (35%) | Gaps: | 33/211 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 127 VTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQ 191
Fly 192 ARDAGSYECQVSTEPKVSARVQLQVVVPRTE---ILGEPD----RYVKAGSNVVLRCIVRGALEP 249
Fly 250 PTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSA 314
Fly 315 TV--TLNIINGESSAS 328 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr11 | NP_001262320.1 | I-set | 125..216 | CDD:254352 | 20/88 (23%) |
Ig | 127..217 | CDD:299845 | 20/89 (22%) | ||
IG_like | 227..320 | CDD:214653 | 22/98 (22%) | ||
IGc2 | 234..311 | CDD:197706 | 18/76 (24%) | ||
fipi | NP_787975.1 | IG_like | 33..115 | CDD:214653 | |
I-set | 128..202 | CDD:254352 | 19/83 (23%) | ||
Ig | 133..>193 | CDD:299845 | 18/69 (26%) | ||
IG_like | 228..307 | CDD:214653 | 22/92 (24%) | ||
Ig | 235..305 | CDD:143165 | 21/83 (25%) | ||
FN3 | 312..415 | CDD:238020 | 1/3 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |