DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and dpr2

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:267 Identity:108/267 - (40%)
Similarity:144/267 - (53%) Gaps:31/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPD- 180
            |..|.....|:||:.|..|.:.|||..||:|||||||.||.||||.....:.:|:||..::..| 
  Fly   106 PVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADS 170

  Fly   181 KYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVV----PRTEILGEPDRYVKAGSNVVLRC 241
            |.|||.:||.|.||:|.|||||:||||:|...:|.|:|    .:..|.|..|.|||.||:|.|.|
  Fly   171 KDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTC 235

  Fly   242 IVRGALEPPTF------IMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGS-----LIIES 295
            .|:   :|.|.      |.||.| ..:......|......:|...|.|  ||:..     |.|.:
  Fly   236 HVK---QPATSAQDIGPIYWYRG-PYILTPFVAHPNDAAIDLQRISME--STLAEKLQSRLRIAN 294

  Fly   296 AKKRDTGNYTCSPSNSPSATVTLNIINGESSASAVTSSA-ATTRAYALSILALLLSVI------- 352
            |:..|||||||.|:.:.:|:|.:|:||.||.|:...|.| .|:.:...|.|.|||:::       
  Fly   295 AQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLAMVASSVVRW 359

  Fly   353 LIGVGHR 359
            ||| |.|
  Fly   360 LIG-GQR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 48/91 (53%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 3/3 (100%)
Ig strand E 183..187 CDD:409353 3/3 (100%)
Ig strand F 197..202 CDD:409353 3/4 (75%)
IG_like 227..320 CDD:214653 35/103 (34%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 1/9 (11%)
Ig strand E 289..293 CDD:409544 1/8 (13%)
Ig strand G 313..316 CDD:409544 1/2 (50%)
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 48/92 (52%)
Ig strand A' 116..118 CDD:409355 0/1 (0%)
Ig strand B 122..130 CDD:409355 2/7 (29%)
CDR1 130..136 CDD:409355 3/5 (60%)
FR2 137..151 CDD:409355 11/13 (85%)
Ig strand C 137..143 CDD:409355 5/5 (100%)
Ig strand C' 149..153 CDD:409355 2/3 (67%)
CDR2 153..162 CDD:409355 1/8 (13%)
Ig strand D 162..167 CDD:409355 1/4 (25%)
FR3 163..192 CDD:409355 14/28 (50%)
Ig strand E 172..178 CDD:409355 3/5 (60%)
Ig strand F 186..192 CDD:409355 4/5 (80%)
IG_like 220..306 CDD:214653 31/91 (34%)
Ig strand B 231..235 CDD:409353 2/3 (67%)
Ig strand C 261..265 CDD:409353 0/3 (0%)
Ig strand E 289..292 CDD:409353 1/2 (50%)
Ig strand F 302..307 CDD:409353 4/4 (100%)
Ig strand G 310..313 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.