DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and dpr2

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:267 Identity:108/267 - (40%)
Similarity:144/267 - (53%) Gaps:31/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPD- 180
            |..|.....|:||:.|..|.:.|||..||:|||||||.||.||||.....:.:|:||..::..| 
  Fly   106 PVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADS 170

  Fly   181 KYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVV----PRTEILGEPDRYVKAGSNVVLRC 241
            |.|||.:||.|.||:|.|||||:||||:|...:|.|:|    .:..|.|..|.|||.||:|.|.|
  Fly   171 KDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTC 235

  Fly   242 IVRGALEPPTF------IMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGS-----LIIES 295
            .|:   :|.|.      |.||.| ..:......|......:|...|.|  ||:..     |.|.:
  Fly   236 HVK---QPATSAQDIGPIYWYRG-PYILTPFVAHPNDAAIDLQRISME--STLAEKLQSRLRIAN 294

  Fly   296 AKKRDTGNYTCSPSNSPSATVTLNIINGESSASAVTSSA-ATTRAYALSILALLLSVI------- 352
            |:..|||||||.|:.:.:|:|.:|:||.||.|:...|.| .|:.:...|.|.|||:::       
  Fly   295 AQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLAMVASSVVRW 359

  Fly   353 LIGVGHR 359
            ||| |.|
  Fly   360 LIG-GQR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 48/91 (53%)
Ig 127..217 CDD:299845 47/90 (52%)
IG_like 227..320 CDD:214653 35/103 (34%)
IGc2 234..311 CDD:197706 29/87 (33%)
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 48/92 (52%)
Ig 116..192 CDD:299845 39/75 (52%)
ig 220..306 CDD:278476 31/91 (34%)
IG_like 220..306 CDD:214653 31/91 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444691
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
88.000

Return to query results.
Submit another query.