DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and CG33543

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:150 Identity:29/150 - (19%)
Similarity:60/150 - (40%) Gaps:33/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 LQIKYVQARDAGSYECQVSTEPKVSARVQL--------QVVVPRTEILGEPDRY--VKAGSNVVL 239
            |..:::...|.|::.|:|:.....:..|.:        :::|.:....|:.::.  |:.|.:.::
  Fly   107 LVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMV 171

  Fly   240 RCIVRGALEPPTFIMWYHGAEQL-AADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGN 303
            .|.|.|.  |...:.|.:..|.: ..:|.:|               ......|.|.:..:.|.|.
  Fly   172 NCFVEGM--PAPEVSWLYNGEYINTVNSTKH---------------NRLSNGLYIRNVSQADAGE 219

  Fly   304 YTC-----SPSNSPSATVTL 318
            |||     :|:.|.|..:|:
  Fly   220 YTCRAMRITPTFSDSDQITI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 6/38 (16%)
Ig 127..217 CDD:299845 6/39 (15%)
IG_like 227..320 CDD:214653 21/99 (21%)
IGc2 234..311 CDD:197706 17/82 (21%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 16/75 (21%)
IG_like 256..336 CDD:214653
IGc2 263..327 CDD:197706
FN3 341..445 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.