DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and dpr4

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:253 Identity:99/253 - (39%)
Similarity:143/253 - (56%) Gaps:25/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 EPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAI-KQP 179
            :||.|..:...||..:|..|.|.|||:.||:::|||||.||.|||||....:..||||.:: .:.
  Fly    44 QPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEG 108

  Fly   180 DKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVR 244
            ...|||:|...|.||:|:||||||||||:|...:|.|||.|.:|||..:.::|:||::.|.|:..
  Fly   109 SDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILGNAELFIKSGSDINLTCLAM 173

  Fly   245 GALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASG-----EGQSTIGSLIIESAKKRDTGNY 304
            .:..||:||.||.|...:             |..:..|     |..:....|:|..|...|:|||
  Fly   174 QSPVPPSFIYWYKGKRVM-------------NYSQRGGINVITERSTRTSKLLIAKATPADSGNY 225

  Fly   305 TCSPSNSPSATVTLNIINGESSASAVTSSAATTRAYALS------ILALLLSVILIGV 356
            |||||:|.||:|.:::||||..|:....:::.|....||      :||..:|:.:..|
  Fly   226 TCSPSSSDSASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMSMTVASV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 46/91 (51%)
Ig 127..217 CDD:299845 46/90 (51%)
IG_like 227..320 CDD:214653 31/97 (32%)
IGc2 234..311 CDD:197706 26/81 (32%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 46/92 (50%)
IG_like 53..145 CDD:214653 46/91 (51%)
ig 153..227 CDD:278476 24/86 (28%)
IG_like 161..>227 CDD:214653 22/78 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444711
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
87.890

Return to query results.
Submit another query.