DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and dpr18

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:409 Identity:99/409 - (24%)
Similarity:142/409 - (34%) Gaps:107/409 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 HTQTSAEAAGGRVS------GPGAGTSEGAGTSSASAASTAISSDESGDPSS-----ATAFSSLA 96
            |:|...||:....|      ..|....|..|:...|:.|..|.:..:.|..:     .|||:||.
  Fly   110 HSQMPIEASNAPHSPIPTKMSRGKIPMETPGSMEFSSNSLPIKNVGTTDQLTTVTMPTTAFASLK 174

  Fly    97 QVSSLLPEASALSAT------SGLV---------------------EPYLDGYATSNVTTQIG-- 132
            ...|.:.:....:.|      ||..                     ||.....:..|:.:.:.  
  Fly   175 VDRSTMKQPIDSTRTRNHWTASGFARVTERPRSKHHHEHHWGPFFEEPINSATSGDNLVSAVHLF 239

  Fly   133 THAYLPCRVKQLGNKSVSWIR--LRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDA 195
            |.|.|.|||..|.:|:|.|:|  .....:|||....:..|.|.....|....|.|.|...|..||
  Fly   240 TEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDA 304

  Fly   196 GSYECQVSTEPKVSARVQLQVVVPRTEILGE-----PDRYVKAGSNVVLRC-------------- 241
            |.|.|||||.|.......|.|:.|...|:.|     .|||.|:||.|.|:|              
  Fly   305 GVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTI 369

  Fly   242 ---------IVRGALEPPT---------------------------FIMWYHGAEQLAADSRRHR 270
                     .|:..:...|                           ||.|....|.|...:.|..
  Fly   370 LKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQGMTNRRL 434

  Fly   271 TQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSASAVTSSAA 335
            :..|..|          ...:.|..||..|:|||:||.....:..|.:.::.||..|:...:..:
  Fly   435 SVSDVWL----------TSRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPAAVQHNIGS 489

  Fly   336 TTRAYALSILALLLSVILI 354
            .|..|:|::|..||.:|.:
  Fly   490 RTEIYSLAMLGHLLVLIFL 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 33/94 (35%)
Ig 127..217 CDD:299845 32/93 (34%)
IG_like 227..320 CDD:214653 29/142 (20%)
IGc2 234..311 CDD:197706 24/126 (19%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 31/82 (38%)
Ig <258..326 CDD:299845 23/67 (34%)
IGc2 <417..461 CDD:197706 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.