DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and dpr18

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:409 Identity:99/409 - (24%)
Similarity:142/409 - (34%) Gaps:107/409 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 HTQTSAEAAGGRVS------GPGAGTSEGAGTSSASAASTAISSDESGDPSS-----ATAFSSLA 96
            |:|...||:....|      ..|....|..|:...|:.|..|.:..:.|..:     .|||:||.
  Fly   110 HSQMPIEASNAPHSPIPTKMSRGKIPMETPGSMEFSSNSLPIKNVGTTDQLTTVTMPTTAFASLK 174

  Fly    97 QVSSLLPEASALSAT------SGLV---------------------EPYLDGYATSNVTTQIG-- 132
            ...|.:.:....:.|      ||..                     ||.....:..|:.:.:.  
  Fly   175 VDRSTMKQPIDSTRTRNHWTASGFARVTERPRSKHHHEHHWGPFFEEPINSATSGDNLVSAVHLF 239

  Fly   133 THAYLPCRVKQLGNKSVSWIR--LRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDA 195
            |.|.|.|||..|.:|:|.|:|  .....:|||....:..|.|.....|....|.|.|...|..||
  Fly   240 TEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDA 304

  Fly   196 GSYECQVSTEPKVSARVQLQVVVPRTEILGE-----PDRYVKAGSNVVLRC-------------- 241
            |.|.|||||.|.......|.|:.|...|:.|     .|||.|:||.|.|:|              
  Fly   305 GVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTI 369

  Fly   242 ---------IVRGALEPPT---------------------------FIMWYHGAEQLAADSRRHR 270
                     .|:..:...|                           ||.|....|.|...:.|..
  Fly   370 LKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQGMTNRRL 434

  Fly   271 TQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSASAVTSSAA 335
            :..|..|          ...:.|..||..|:|||:||.....:..|.:.::.||..|:...:..:
  Fly   435 SVSDVWL----------TSRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPAAVQHNIGS 489

  Fly   336 TTRAYALSILALLLSVILI 354
            .|..|:|::|..||.:|.:
  Fly   490 RTEIYSLAMLGHLLVLIFL 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 33/94 (35%)
Ig strand B 135..139 CDD:409353 2/3 (67%)
Ig strand C 148..152 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 2/3 (67%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 29/142 (20%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 2/3 (67%)
Ig strand E 289..293 CDD:409544 0/3 (0%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 31/82 (38%)
Ig strand B 242..246 CDD:409433 2/3 (67%)
Ig strand C 255..264 CDD:409433 3/8 (38%)
Ig strand E 292..296 CDD:409433 2/3 (67%)
Ig strand F 306..311 CDD:409433 2/4 (50%)
Ig <417..474 CDD:472250 17/66 (26%)

Return to query results.
Submit another query.