DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and dpr8

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:326 Identity:109/326 - (33%)
Similarity:162/326 - (49%) Gaps:62/326 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GILCLTIASHTQTSAEAAGGRVSGPGAGTSEGAGTSSASAASTAISSDESGDPSSATAFSSLAQV 98
            |||||.                    ||.::||                     |...|:...|.
  Fly    10 GILCLL--------------------AGCTDGA---------------------SKRFFTDFLQD 33

  Fly    99 SSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVD 163
               ||       |.|...|..|....:|:|..:|....|.||||.|||::|||:|.||.|:|||.
  Fly    34 ---LP-------TPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVG 88

  Fly   164 RAVFIADQRFLAIKQPD-KYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEP 227
            |..:.:||||.|:..|. :.|||:|:|.|.:|:|.||||:||.|.:...|.|.:|.|.|:|:|.|
  Fly    89 RYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGP 153

  Fly   228 DRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLI 292
            :.::..||.:.|.|||:.|.|||..::|.|..|.:..||.|....|      .:.:|..|...|:
  Fly   154 ELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISL------VTEKGVLTTSRLL 212

  Fly   293 IESAKKRDTGNYTCSPSNSPSATVTLNIINGESSASAVT----SSAATTRAYALSILALLLSVIL 353
            ::.|..:|:|.|||:|||:...:|.::|::||..|:..|    :|.|:.....|.::.|..|.::
  Fly   213 VQKAITQDSGLYTCTPSNANPTSVRVHIVDGEHPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLM 277

  Fly   354 I 354
            :
  Fly   278 L 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 45/91 (49%)
Ig 127..217 CDD:299845 44/90 (49%)
IG_like 227..320 CDD:214653 31/92 (34%)
IGc2 234..311 CDD:197706 28/76 (37%)
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 41/79 (52%)
V-set 52..143 CDD:284989 44/90 (49%)
IG_like 153..238 CDD:214653 31/90 (34%)
ig 153..232 CDD:278476 30/84 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.