DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and dpr8

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:326 Identity:109/326 - (33%)
Similarity:162/326 - (49%) Gaps:62/326 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GILCLTIASHTQTSAEAAGGRVSGPGAGTSEGAGTSSASAASTAISSDESGDPSSATAFSSLAQV 98
            |||||.                    ||.::||                     |...|:...|.
  Fly    10 GILCLL--------------------AGCTDGA---------------------SKRFFTDFLQD 33

  Fly    99 SSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVD 163
               ||       |.|...|..|....:|:|..:|....|.||||.|||::|||:|.||.|:|||.
  Fly    34 ---LP-------TPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVG 88

  Fly   164 RAVFIADQRFLAIKQPD-KYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEP 227
            |..:.:||||.|:..|. :.|||:|:|.|.:|:|.||||:||.|.:...|.|.:|.|.|:|:|.|
  Fly    89 RYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGP 153

  Fly   228 DRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLI 292
            :.::..||.:.|.|||:.|.|||..::|.|..|.:..||.|....|      .:.:|..|...|:
  Fly   154 ELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISL------VTEKGVLTTSRLL 212

  Fly   293 IESAKKRDTGNYTCSPSNSPSATVTLNIINGESSASAVT----SSAATTRAYALSILALLLSVIL 353
            ::.|..:|:|.|||:|||:...:|.::|::||..|:..|    :|.|:.....|.::.|..|.::
  Fly   213 VQKAITQDSGLYTCTPSNANPTSVRVHIVDGEHPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLM 277

  Fly   354 I 354
            :
  Fly   278 L 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 45/91 (49%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 2/3 (67%)
Ig strand E 183..187 CDD:409353 3/3 (100%)
Ig strand F 197..202 CDD:409353 3/4 (75%)
IG_like 227..320 CDD:214653 31/92 (34%)
Ig strand B 237..241 CDD:409544 1/3 (33%)
Ig strand C 252..256 CDD:409544 0/3 (0%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
dpr8NP_727781.1 IG_like 51..131 CDD:214653 41/79 (52%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 2/3 (67%)
Ig strand E 109..113 CDD:409353 3/3 (100%)
Ig strand F 123..128 CDD:409353 3/4 (75%)
Ig_3 153..230 CDD:464046 28/82 (34%)

Return to query results.
Submit another query.