| Sequence 1: | NP_001262320.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_036019026.1 | Gene: | Negr1 / 320840 | MGIID: | 2444846 | Length: | 362 | Species: | Mus musculus |
| Alignment Length: | 353 | Identity: | 86/353 - (24%) |
|---|---|---|---|
| Similarity: | 132/353 - (37%) | Gaps: | 110/353 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 95 LAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIR-----L 154
Fly 155 RDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTE--PKVSARVQLQVV 217
Fly 218 VPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYH------------------------G 258
Fly 259 AEQLAA-------DSRRHRTQLD--PNL---------PEASG----------------------- 282
Fly 283 -EGQ--------STIGSLIIESAKKRDTGNYTCSPSN---SPSATVTLNIINGESSASAVTSSAA 335
Fly 336 TTRAYALS----------ILALLLSVIL 353 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr11 | NP_001262320.1 | I-set | 125..216 | CDD:254352 | 26/97 (27%) |
| Ig | 127..217 | CDD:299845 | 25/96 (26%) | ||
| IG_like | 227..320 | CDD:214653 | 33/169 (20%) | ||
| IGc2 | 234..311 | CDD:197706 | 30/153 (20%) | ||
| Negr1 | XP_036019026.1 | FR1 | 38..55 | CDD:409353 | 5/16 (31%) |
| Ig strand A' | 40..46 | CDD:409353 | 1/5 (20%) | ||
| IG_like | 41..129 | CDD:214653 | 26/96 (27%) | ||
| Ig strand B | 48..56 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 56..60 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 61..68 | CDD:409353 | 2/7 (29%) | ||
| Ig strand C | 61..67 | CDD:409353 | 2/6 (33%) | ||
| CDR2 | 69..79 | CDD:409353 | 1/9 (11%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 0/2 (0%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 80..115 | CDD:409353 | 13/41 (32%) | ||
| Ig strand D | 84..91 | CDD:409353 | 2/11 (18%) | ||
| Ig strand E | 94..100 | CDD:409353 | 3/7 (43%) | ||
| Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
| Ig strand G | 120..129 | CDD:409353 | 3/9 (33%) | ||
| FR4 | 122..129 | CDD:409353 | 2/6 (33%) | ||
| Ig strand A' | 139..144 | CDD:409353 | 1/4 (25%) | ||
| IGc2 | 146..204 | CDD:197706 | 13/59 (22%) | ||
| Ig strand B | 150..157 | CDD:409353 | 3/6 (50%) | ||
| Ig strand C | 163..168 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 170..172 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 180..186 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 193..200 | CDD:409353 | 1/6 (17%) | ||
| Ig_3 | 219..295 | CDD:404760 | 14/75 (19%) | ||
| putative Ig strand A | 219..225 | CDD:409353 | 1/5 (20%) | ||
| Ig strand B | 235..239 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 248..252 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 288..293 | CDD:409353 | 4/4 (100%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||