DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and DIP-kappa

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:265 Identity:75/265 - (28%)
Similarity:105/265 - (39%) Gaps:45/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 TSSASAASTAISSDESGDPSSATAFSSLAQVSS--------LLPEASALSATSGLVEPYLDGYAT 124
            |..|:||.|.:          .||..:||::.|        ....|...|......||      .
  Fly    32 TIIATAAVTML----------MTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEP------I 80

  Fly   125 SNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKY 189
            :|||..:|..|.:.|.|:.|....|:|:|:....||::...|...:.|........:.|.|.||.
  Fly    81 ANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKE 145

  Fly   190 VQARDAGSYECQVSTEPKVSARVQLQVVVPR--TEILGEPDRYVKAGSNVVLRCIVRGALEPPTF 252
            |:..|.|.|.|||:|:|..|.:..||||||.  .|.|...|..|:.|.|:.|.|..||..||  :
  Fly   146 VEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEP--Y 208

  Fly   253 IMWYH--GAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSAT 315
            :||..  |.|.|...  .|...:|..|             |.|....:.....|.|..||....:
  Fly   209 VMWRREDGEEMLIGG--EHVNVVDGEL-------------LHITKVSRLHMAAYLCVASNGVPPS 258

  Fly   316 VTLNI 320
            ::..:
  Fly   259 ISKRV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 30/90 (33%)
Ig 127..217 CDD:299845 30/89 (34%)
IG_like 227..320 CDD:214653 24/94 (26%)
IGc2 234..311 CDD:197706 21/78 (27%)
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 30/91 (33%)
IG_like 82..174 CDD:214653 32/91 (35%)
IG_like 184..267 CDD:214653 24/97 (25%)
IGc2 191..255 CDD:197706 22/80 (28%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.