DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and dpr14

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:309 Identity:100/309 - (32%)
Similarity:157/309 - (50%) Gaps:34/309 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GAGTSSASAASTAISSDESGDPSSATAFSSLAQVSSLL---PEASALSATSGLV-EP---YLDGY 122
            |:|::     ||.:....:|||......:...:.||..   ||...|..|.... ||   :.|.|
  Fly    20 GSGST-----STTLKRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETTTHEPFPFFADPY 79

  Fly   123 ATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLR--DGHILTVDRAVFIADQRF-LAIKQPDKYWT 184
            .|.|::||:.:..||.|||..|..|:|||:|.|  |..::|..:..:..|.|: |..::|:. |.
  Fly    80 TTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPND-WK 143

  Fly   185 LQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGE-----PDRYVKAGSNVVLRCIVR 244
            |.|::...||.|.||||||:.|.:...|.|.::||..|||.|     |::|.||||.:.|:|::.
  Fly   144 LLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVIS 208

  Fly   245 GALEPPTFIMWYHGAEQLAADSRRH----RTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYT 305
            ....|.::|.|.||...|..|:.|.    :|.:.|.         ..:..|.|.:|.::||||||
  Fly   209 KIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPG---------RALSRLYIANANRQDTGNYT 264

  Fly   306 CSPSNSPSATVTLNIINGESSASAVTSSAATTRAYALSILALLLSVILI 354
            |...|..:.||.::::|||..|:...::.:..:|.|.:::.|.|..:.|
  Fly   265 CMLGNEITETVVVHVLNGEEPAAMQHANGSRQKANASTMVVLFLVYVCI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 36/93 (39%)
Ig 127..217 CDD:299845 35/92 (38%)
IG_like 227..320 CDD:214653 31/96 (32%)
IGc2 234..311 CDD:197706 24/80 (30%)
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 32/80 (40%)
Ig 84..169 CDD:299845 33/85 (39%)
IG_like 191..279 CDD:214653 31/96 (32%)
Ig 201..274 CDD:143165 23/81 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444684
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
87.890

Return to query results.
Submit another query.