Sequence 1: | NP_001262320.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101611.1 | Gene: | Dscaml1 / 315615 | RGDID: | 1304887 | Length: | 2111 | Species: | Rattus norvegicus |
Alignment Length: | 270 | Identity: | 71/270 - (26%) |
---|---|---|---|
Similarity: | 104/270 - (38%) | Gaps: | 55/270 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 LAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQ--------------IGTHAYLPCRVKQLG 145
Fly 146 NKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVS-TEPKVS 209
Fly 210 ARVQLQVVVPRTEILGEPDR----YVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRH- 269
Fly 270 -----RTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSASA 329
Fly 330 VTSSAATTRA 339 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr11 | NP_001262320.1 | I-set | 125..216 | CDD:254352 | 25/105 (24%) |
Ig | 127..217 | CDD:299845 | 25/104 (24%) | ||
IG_like | 227..320 | CDD:214653 | 30/102 (29%) | ||
IGc2 | 234..311 | CDD:197706 | 25/82 (30%) | ||
Dscaml1 | NP_001101611.1 | IG | 101..173 | CDD:214652 | |
IGc2 | 101..168 | CDD:197706 | |||
Ig | 183..276 | CDD:299845 | |||
IG_like | 195..276 | CDD:214653 | |||
I-set | 291..369 | CDD:254352 | |||
IGc2 | 298..359 | CDD:197706 | |||
IGc2 | 386..447 | CDD:197706 | |||
I-set | 466..560 | CDD:254352 | |||
Ig | 466..556 | CDD:299845 | |||
IGc2 | 577..635 | CDD:197706 | 4/17 (24%) | ||
IG_like | 665..744 | CDD:214653 | 24/87 (28%) | ||
Ig | 673..739 | CDD:143165 | 19/74 (26%) | ||
I-set | 748..843 | CDD:254352 | 30/113 (27%) | ||
Ig7_DSCAM | 765..843 | CDD:143211 | 26/95 (27%) | ||
I-set | 849..942 | CDD:254352 | 5/10 (50%) | ||
Ig | 861..949 | CDD:299845 | |||
FN3 | 945..1039 | CDD:238020 | |||
FN3 | 1046..1143 | CDD:238020 | |||
fn3 | 1151..1237 | CDD:278470 | |||
FN3 | 1249..1340 | CDD:238020 | |||
IGc2 | 1364..1428 | CDD:197706 | |||
FN3 | 1442..1532 | CDD:238020 | |||
FN3 | 1546..1618 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |