| Sequence 1: | NP_001262320.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038937320.1 | Gene: | Kirrel3 / 315546 | RGDID: | 1311382 | Length: | 869 | Species: | Rattus norvegicus |
| Alignment Length: | 263 | Identity: | 62/263 - (23%) |
|---|---|---|---|
| Similarity: | 103/263 - (39%) | Gaps: | 46/263 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 106 SALSAT--SGLVEPYLDGYATS---NVTTQIGTHAYLPCRVKQLGNKSVS--WIRLRDGHILTVD 163
Fly 164 RAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSA---RVQLQVVVPRTEILG 225
Fly 226 EPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGS 290
Fly 291 LIIESAKKRDTGN-YTCSPSNSPSATVTLNIINGESSASAVTSSAATTRAYALSILALLLSVILI 354
Fly 355 GVG 357 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr11 | NP_001262320.1 | I-set | 125..216 | CDD:254352 | 24/98 (24%) |
| Ig | 127..217 | CDD:299845 | 23/94 (24%) | ||
| IG_like | 227..320 | CDD:214653 | 19/93 (20%) | ||
| IGc2 | 234..311 | CDD:197706 | 17/77 (22%) | ||
| Kirrel3 | XP_038937320.1 | IG_like | 54..143 | CDD:214653 | |
| Ig strand A' | 56..60 | CDD:409353 | |||
| Ig strand B | 64..71 | CDD:409353 | |||
| Ig strand C | 78..82 | CDD:409353 | |||
| Ig strand C' | 84..87 | CDD:409353 | |||
| Ig strand D | 97..101 | CDD:409353 | |||
| Ig strand E | 104..116 | CDD:409353 | |||
| Ig strand G | 132..143 | CDD:409353 | |||
| IgI_2_KIRREL3-like | 149..246 | CDD:409416 | |||
| Ig strand B | 166..170 | CDD:409416 | |||
| Ig strand C | 180..184 | CDD:409416 | |||
| Ig strand E | 210..214 | CDD:409416 | |||
| Ig strand F | 224..229 | CDD:409416 | |||
| Ig strand G | 239..242 | CDD:409416 | |||
| Ig | <267..334 | CDD:416386 | 6/15 (40%) | ||
| Ig strand B | 267..274 | CDD:409353 | |||
| Ig strand C | 279..286 | CDD:409353 | |||
| Ig strand C' | 288..291 | CDD:409353 | |||
| Ig strand D | 298..302 | CDD:409353 | |||
| Ig strand E | 304..310 | CDD:409353 | |||
| Ig strand G | 321..334 | CDD:409353 | 4/12 (33%) | ||
| Ig | 335..416 | CDD:416386 | 25/102 (25%) | ||
| Ig strand A' | 343..347 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 350..360 | CDD:409353 | 2/11 (18%) | ||
| Ig strand C | 365..371 | CDD:409353 | 1/5 (20%) | ||
| Ig strand E | 381..387 | CDD:409353 | 2/24 (8%) | ||
| IgI_5_KIRREL3 | 418..515 | CDD:409479 | 23/106 (22%) | ||
| Ig strand B | 436..440 | CDD:409479 | 0/3 (0%) | ||
| Ig strand C | 450..454 | CDD:409479 | 1/3 (33%) | ||
| Ig strand E | 481..485 | CDD:409479 | 1/3 (33%) | ||
| Ig strand F | 496..501 | CDD:409479 | 2/4 (50%) | ||
| Ig strand G | 509..512 | CDD:409479 | 0/4 (0%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||