DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Fas2

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:363 Identity:85/363 - (23%)
Similarity:125/363 - (34%) Gaps:100/363 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WK-NRSRSEMQTLETRVRPLQGAQLTQLLLGGILCLTIASHTQTSAEAAGGRVSGPGAGTSEGAG 67
            || ||:.:.:.....|.:|   ...|:.|.|..|.|.|   |..|.| .||:.            
  Fly    69 WKDNRNNTILPKPNGRNQP---PMYTETLPGESLALMI---TSLSVE-MGGKY------------ 114

  Fly    68 TSSASAASTAISSDESGDPSSATAFSSLAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIG 132
            ..:||.|:|.|.  |.|    .|..:.:|...:..||               :.|.|      :|
  Fly   115 YCTASYANTEIL--EKG----VTIKTYVAITWTNAPE---------------NQYPT------LG 152

  Fly   133 THAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGS 197
            ....:.|.||...|.::.|:|..|....|.|:.|...:             .|.|:.||..|.|.
  Fly   153 QDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTN-------------GLLIRNVQESDEGI 204

  Fly   198 YECQ---VSTEPKVSARVQLQVVVPRTEILGEPDRY-VKAGSNVVLRCIVRGALEPPTFIMWYHG 258
            |.|:   :.|...:...::::|.: :.||:..|... ...|......|..||  :|...|.|...
  Fly   205 YTCRAAVIETGELLERTIRVEVFI-QPEIISLPTNLEAVEGKPFAANCTARG--KPVPEISWIRD 266

  Fly   259 AEQL---AADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSN---------- 310
            |.||   .||    |.|::|.           .|.:.|.|..:.|.|.|||...|          
  Fly   267 ATQLNVATAD----RFQVNPQ-----------TGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTK 316

  Fly   311 -----SPSATVTLNIINGESSASAVTSSAATTRAYALS 343
                 .|......|:....:...|:|..|....|.|::
  Fly   317 LNVLVRPQIYELYNVTGARTKEIAITCRAKGRPAPAIT 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 20/93 (22%)
Ig 127..217 CDD:299845 20/92 (22%)
IG_like 227..320 CDD:214653 26/111 (23%)
IGc2 234..311 CDD:197706 24/94 (26%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 25/88 (28%)
IG_like 144..226 CDD:214653 24/115 (21%)
IGc2 152..209 CDD:197706 19/69 (28%)
I-set 230..319 CDD:254352 27/105 (26%)
IGc2 243..309 CDD:197706 24/82 (29%)
IG_like 330..424 CDD:214653 6/25 (24%)
IGc2 339..412 CDD:197706 5/16 (31%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.