DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and DIP-alpha

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:229 Identity:66/229 - (28%)
Similarity:95/229 - (41%) Gaps:24/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRA 165
            ||...|.|.|.......:::  :.|||:..:|..|...|.|:.||...|.|::.....|..:...
  Fly    27 LLLIVSLLEAIGAFQPEFVE--SISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHEN 89

  Fly   166 VFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGE---P 227
            |...:.|..........|.|.||.|...|.|.|.||::|:|..|....|.||:| .:.:.|   .
  Fly    90 VITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIP-PDFISEDTSS 153

  Fly   228 DRYVKAGSNVVLRCIVRGALEPPTFIMWYH--GAEQLAADSRRHRTQLDPNLPEASGEGQSTIGS 290
            |..|..||:|.|.|..||..||  .:.|..  |.|.:..|:...:|.    .|...||      .
  Fly   154 DVIVPEGSSVRLTCRARGYPEP--IVTWRREDGNEIVLKDNVGTKTL----APSFRGE------V 206

  Fly   291 LIIESAKKRDTGNYTCSPSN----SPSATVTLNI 320
            |.:....:.:.|:|.|..||    |.|..::|:|
  Fly   207 LKLSKISRNEMGSYLCIASNGVPPSVSKRISLSI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 28/90 (31%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 2/3 (67%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 28/98 (29%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 0/3 (0%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 1/2 (50%)
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 24/79 (30%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 2/7 (29%)
Ig 152..240 CDD:472250 28/99 (28%)
Ig strand B 163..167 CDD:409275 2/3 (67%)
Ig strand C 176..180 CDD:409275 0/3 (0%)
Ig strand E 205..209 CDD:409275 2/9 (22%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 1/2 (50%)
Ig 244..337 CDD:472250
Ig strand B 261..265 CDD:409353
Ig strand C 274..278 CDD:409353
Ig strand E 305..309 CDD:409353
Ig strand F 319..324 CDD:409353
Ig strand G 332..335 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.