DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and kirre

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster


Alignment Length:381 Identity:77/381 - (20%)
Similarity:137/381 - (35%) Gaps:106/381 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MQTLETRVRPLQGAQLTQLLLGGILCLTIASHTQTSAEAAGGRVSGPGAGTSEGAGTSSASAAST 76
            |::....|.||....:..|||..|.....:...::|..:..|..|...:.:|..:|:|||:|:|.
  Fly     4 MRSSRLLVLPLILVLILTLLLQPIAVHAKSKKNKSSQSSHHGDSSSSSSSSSSSSGSSSAAASSA 68

  Fly    77 AISSDESGDPSSATAFSSLAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRV 141
            ...|...|..:....|:                     :||       .:.|..:|:...|||||
  Fly    69 NDESKPKGGDNGGQHFA---------------------MEP-------QDQTAVVGSRVTLPCRV 105

  Fly   142 -KQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTE 205
             :::|  ::.|  .:|...|...|.:...::..:.....:..::|.|..:...|...|:|||...
  Fly   106 MEKVG--ALQW--TKDDFGLGQHRNLSGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPG 166

  Fly   206 PK----VSAR-VQLQVVVPRTE--------ILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYH 257
            |:    :.:| .:|.|:||...        ::...||.::      |.|:.:|. :|...|.|..
  Fly   167 PQGEQGIRSRFAKLTVLVPPEAPKITQGDYLVTTEDREIE------LECVSQGG-KPAAEITWID 224

  Fly   258 G-----------AEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGN--YTCSPS 309
            |           .::..|||||                  .....|::.|.|::..|  :||...
  Fly   225 GLGNVLTKGIEYVKEPLADSRR------------------ITARSILKLAPKKEHHNTTFTCQAQ 271

  Fly   310 NSPSAT---------------VTLNIING-------ESSASAVTSSAATTRAYALS 343
            |:...|               |.::::.|       ...|..:.|..|....:.||
  Fly   272 NTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELS 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 22/96 (23%)
Ig 127..217 CDD:299845 22/95 (23%)
IG_like 227..320 CDD:214653 23/120 (19%)
IGc2 234..311 CDD:197706 18/89 (20%)
kirreNP_001245505.1 Ig 87..183 CDD:299845 24/106 (23%)
IG_like 88..182 CDD:214653 23/104 (22%)
C2-set_2 189..279 CDD:285423 22/114 (19%)
Ig_2 307..379 CDD:290606 5/21 (24%)
I-set 382..462 CDD:254352
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.