DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and rst

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:204 Identity:47/204 - (23%)
Similarity:86/204 - (42%) Gaps:34/204 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 TTQIGTHAYLPCRV--KQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDK-YWTLQIKY 189
            |..:|....|||||  ||   .::.|.:...|...:.|.:.|   :|:..:...:: .::|.|..
  Fly    38 TAVVGARVTLPCRVINKQ---GTLQWTKDDFGLGTSRDLSGF---ERYAMVGSDEEGDYSLDIYP 96

  Fly   190 VQARDAGSYECQVSTEPKVSARVQ-----LQVVVP-------RTEILGEPDRYVKAGSNVVLRCI 242
            |...|...|:||||..|:....::     |.|:||       :.:::     |......|.:.|:
  Fly    97 VMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLV
PPEAPKITQGDVI-----YATEDRKVEIECV 156

  Fly   243 VRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLI-IESAKKRDTGNYTC 306
            ..|. :|...|.|..|...:..|:..:  .:.| ||:   :.:.|..|:: :...|:....|::|
  Fly   157 SVGG-KPAAEITWIDGLGNVLTDNIEY--TVIP-LPD---QRRFTAKSVLRLTPKKEHHNTNFSC 214

  Fly   307 SPSNSPSAT 315
            ...|:...|
  Fly   215 QAQNTADRT 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 25/95 (26%)
Ig 127..217 CDD:299845 25/96 (26%)
IG_like 227..320 CDD:214653 19/90 (21%)
IGc2 234..311 CDD:197706 16/77 (21%)
rstNP_001284835.1 IG_like 34..130 CDD:214653 26/97 (27%)
Ig 42..114 CDD:299845 22/77 (29%)
C2-set_2 135..225 CDD:285423 19/101 (19%)
Ig_3 265..329 CDD:290638
I-set 346..420 CDD:254352
Ig 360..425 CDD:299845
Ig5_KIRREL3-like 428..524 CDD:143235
IG_like 435..524 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.