DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Kirrel1

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:275 Identity:76/275 - (27%)
Similarity:111/275 - (40%) Gaps:68/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 SSLLPE----------------ASALSATSGLVEPYLDGYAT------SNVTTQIGTHAYLPCRV 141
            |||||:                |..:..|..|..|   |..|      ::.|...|..|.|||  
  Rat    15 SSLLPKKPRFLSQKMWAPHLVVAYLIFVTLALALP---GTQTRFSQEPADQTVVAGHRAVLPC-- 74

  Fly   142 KQLGNKS--VSWIRLRDGHILTVDRAVFIADQRFLAIKQPDK-YWTLQIKYVQARDAGSYECQVS 203
             .|.|.|  |.|  .:||..|.:.:.: .|..|:..:...|. .:.|:|...:..|..|||||.:
  Rat    75 -VLLNYSGIVQW--TKDGLALGMGQGL-KAWPRYRVVGSADAGQYNLEITDAELSDDASYECQAT 135

  Fly   204 TEPKVSARVQLQVVVP--RTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYH-GAEQLAAD 265
            .....|.|.:|.|::|  .|.|.|.|...::||:...|.|....| :|...|:|:. |.:|..|.
  Rat   136 EAALRSRRAKLTVLIPPEDTRIDGGPVILLQAGTPYNLTCRAFNA-KPAATIIWFRDGTQQEGAV 199

  Fly   266 SRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGN-YTCSPSNS--PSA------------- 314
            :   .|:|     ...|:.::||..|:|:.. ..|.|. :||...|.  |:.             
  Rat   200 T---STEL-----LKDGKRETTISQLLIQPT-DLDIGRVFTCRSMNEAIPNGKETSIELDVHHPP 255

  Fly   315 TVTLNI-----INGE 324
            ||||:|     :.||
  Rat   256 TVTLSIEPQTVLEGE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 28/93 (30%)
Ig 127..217 CDD:299845 28/92 (30%)
IG_like 227..320 CDD:214653 29/109 (27%)
IGc2 234..311 CDD:197706 21/78 (27%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 28/99 (28%)
Ig 57..148 CDD:299845 28/96 (29%)
Ig2_KIRREL3-like 170..251 CDD:143236 22/90 (24%)
I-set 255..336 CDD:254352 7/16 (44%)
Ig_2 259..337 CDD:290606 4/12 (33%)
Ig_2 340..437 CDD:290606
IG_like 346..437 CDD:214653
Ig5_KIRREL3 439..536 CDD:143306
IG_like 451..536 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.