DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and sdk

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster


Alignment Length:320 Identity:71/320 - (22%)
Similarity:113/320 - (35%) Gaps:92/320 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RSEMQTLETRVRPLQGAQLTQLLLGGILCLTIASHTQTSAEAAGGRVSGPGAGTSEGAGTSSASA 73
            |.:.:|.:.||:.|...::.::                       |.|..|.|:.:|        
  Fly   449 RVKTKTAKNRVKRLAQPRILRV-----------------------RASHAGLGSEKG-------- 482

  Fly    74 ASTAISSDESGDPSSATAFSSLAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLP 138
                 |...|.|......|:| |.:..|.|:                     |||...|..|.:.
  Fly   483 -----SESGSSDRRKEFRFAS-APIMELPPQ---------------------NVTALDGKDATIS 520

  Fly   139 CRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVS 203
            ||.....|.:::|| ..:..::.:...|.|.:...|.|..           :::.|||.|.|..:
  Fly   521 CRAVGSPNPNITWI-YNETQLVDISSRVQILESGDLLISN-----------IRSVDAGLYICVRA 573

  Fly   204 TEP-KVSARVQLQVVVPRTEILGEP-DRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLA--A 264
            .|. .|.....|.|:| ||:|:..| |..|..|....|:|.|......|..|.||...:...  :
  Fly   574 NEAGSVKGEAYLSVLV-RTQIIQPPVDTTVLLGLTATLQCKVSSDPSVPYNIDWYREGQSSTPIS 637

  Fly   265 DSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTC---SPSNSPSATVTLNII 321
            :|:|...|.|              |.|.|::.:..|.|:|.|   ||..:.:....|::|
  Fly   638 NSQRIGVQAD--------------GQLEIQAVRASDVGSYACVVTSPGGNETRAARLSVI 683

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 22/91 (24%)
Ig 127..217 CDD:299845 21/90 (23%)
IG_like 227..320 CDD:214653 25/98 (26%)
IGc2 234..311 CDD:197706 21/81 (26%)
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845
IG_like 280..356 CDD:214653
Ig 280..343 CDD:299845