DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and dpr9

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_996215.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:375 Identity:132/375 - (35%)
Similarity:195/375 - (52%) Gaps:66/375 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ASHTQTSAEAAGGRVSG------PGAGTSEGAGT----------------SSASAASTAISSDES 83
            :|:.....|..||..:|      ||....:|:|:                |.|::.|.|:::|.|
  Fly   140 SSNNALPNEGVGGSAAGAGEAAAPGPTGIDGSGSGNNSSGNNKNGHPAAGSGAASESAALTTDAS 204

  Fly    84 ----GDPSSATAF--SSLAQVSSLLPEASALSATSGL------------VEPYLDGYATSNVTTQ 130
                |..::.|..  |||.:.||......:....||.            ..||.|...:.|||..
  Fly   205 RSSVGGATTITGIPSSSLHKASSASSNTFSSQLASGFHRNSIDLEEARNAGPYFDKAFSKNVTAL 269

  Fly   131 IGTHAYLPCRVKQLGNKS----VSWIRLRDGHILTVDRAVFIADQRFLAIKQPD-KYWTLQIKYV 190
            :|..|||.||||.||||:    |||:|.||.|:|||.|..:.:||||.||.||. :.|.|||||.
  Fly   270 LGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYTYTSDQRFRAIHQPQTEDWMLQIKYP 334

  Fly   191 QARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMW 255
            |.||:|.|||||||.|.:|..:.|.||.|.|||:|.||.|:::||.:.|.||::.:.|||.:|.|
  Fly   335 QHRDSGIYECQVSTTPHMSHYIHLNVVEPSTEIIGAPDLYIESGSTINLTCIIQNSPEPPAYIFW 399

  Fly   256 YHG------AEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSA 314
            .|.      .:.:..||.|....:..|      :|.:|...|:|:||:..|:|:|.|:|||:...
  Fly   400 NHNNAFPSHPQIINYDSPRGGVSVVTN------KGDTTTSFLLIKSARPSDSGHYQCNPSNAKPK 458

  Fly   315 TVTLNIING---------ESSASAVTSSAATTRAYALSILALLLSVILIG 355
            :||::::||         .||.:|..:||::..|::||:...:..::.:|
  Fly   459 SVTVHVLNGVSHSVSRGVPSSNAARGTSASSPLAHSLSVCVPVCVLLQLG 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 54/95 (57%)
Ig strand B 135..139 CDD:409353 3/3 (100%)
Ig strand C 148..152 CDD:409353 2/7 (29%)
Ig strand E 183..187 CDD:409353 2/3 (67%)
Ig strand F 197..202 CDD:409353 3/4 (75%)
IG_like 227..320 CDD:214653 33/98 (34%)
Ig strand B 237..241 CDD:409544 1/3 (33%)
Ig strand C 252..256 CDD:409544 1/3 (33%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
dpr9NP_996215.1 IG_like 263..360 CDD:214653 54/96 (56%)
Ig strand B 274..278 CDD:409355 3/3 (100%)
Ig strand C 291..295 CDD:409355 2/3 (67%)
Ig strand E 327..331 CDD:409355 2/3 (67%)
Ig strand F 341..346 CDD:409355 3/4 (75%)
IG_like 371..464 CDD:214653 33/98 (34%)
Ig strand B 381..385 CDD:143220 1/3 (33%)
Ig strand C 396..400 CDD:143220 1/3 (33%)
Ig strand E 431..437 CDD:143220 2/5 (40%)
Ig strand F 447..452 CDD:143220 2/4 (50%)

Return to query results.
Submit another query.