DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and dpr9

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:336 Identity:127/336 - (37%)
Similarity:184/336 - (54%) Gaps:43/336 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GGRVSGPGAGTSEGAGTSSASAASTAISSDESGDPSSATAFSSLAQVSSLLPEASALSATSGL-- 114
            |...:|.||.:...|.|:.||.:|...::..:|.||     |||.:.||......:....||.  
  Fly   184 GHPAAGSGAASESAALTTDASRSSVGGATTITGIPS-----SSLHKASSASSNTFSSQLASGFHR 243

  Fly   115 ----------VEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKS----VSWIRLRDGHILTVDRA 165
                      ..||.|...:.|||..:|..|||.||||.||||:    |||:|.||.|:|||.|.
  Fly   244 NSIDLEEARNAGPYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRY 308

  Fly   166 VFIADQRFLAIKQPD-KYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEPDR 229
            .:.:||||.||.||. :.|.|||||.|.||:|.|||||||.|.:|..:.|.||.|.|||:|.||.
  Fly   309 TYTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPSTEIIGAPDL 373

  Fly   230 YVKAGSNVVLRCIVRGALEPPTFIMWYHG------AEQLAADSRRHRTQLDPNLPEASGEGQSTI 288
            |:::||.:.|.||::.:.|||.:|.|.|.      .:.:..||.|....:..|      :|.:|.
  Fly   374 YIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTN------KGDTTT 432

  Fly   289 GSLIIESAKKRDTGNYTCSPSNSPSATVTLNIING---------ESSASAVTSSAATTRAYALSI 344
            ..|:|:||:..|:|:|.|:|||:...:||::::||         .||.:|..:||::..|::||:
  Fly   433 SFLLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNGVSHSVSRGVPSSNAARGTSASSPLAHSLSV 497

  Fly   345 LALLLSVILIG 355
            ...:..::.:|
  Fly   498 CVPVCVLLQLG 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 54/95 (57%)
Ig 127..217 CDD:299845 53/94 (56%)
IG_like 227..320 CDD:214653 33/98 (34%)
IGc2 234..311 CDD:197706 27/82 (33%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 54/97 (56%)
IG_like 263..360 CDD:214653 54/96 (56%)
IG_like 371..464 CDD:214653 33/98 (34%)
IGc2 377..456 CDD:197706 28/84 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444701
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
87.890

Return to query results.
Submit another query.