DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Lsamp

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:234 Identity:72/234 - (30%)
Similarity:96/234 - (41%) Gaps:36/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 TSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIK 188
            |.|:|.:.|..|.|.|.|:. .|..|:|:. |.| |:......:..|.|....|:....::|:|:
Mouse    69 TDNITVRQGDTAILRCVVED-KNSKVAWLN-RSG-IIFAGHDKWSLDPRVELEKRHALEYSLRIQ 130

  Fly   189 YVQARDAGSYECQVST--EPKVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPT 251
            .|...|.|||.|.|.|  |||.| :|.|.|.||........|..|..||||.|.|:..|..||  
Mouse   131 KVDVYDEGSYTCSVQTQHEPKTS-QVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEP-- 192

  Fly   252 FIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSAT- 315
            .|.|.|               |.|...|..||.:    .|.|....:..:|.|.|..:|..|:. 
Mouse   193 VITWRH---------------LTPLGREFEGEEE----YLEILGITREQSGKYECKAANEVSSAD 238

  Fly   316 -----VTLN---IINGESSASAVTSSAATTRAYALSILA 346
                 ||:|   .|....|..|.|...|:.:..|.::.|
Mouse   239 VKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 32/92 (35%)
Ig 127..217 CDD:299845 31/91 (34%)
IG_like 227..320 CDD:214653 29/101 (29%)
IGc2 234..311 CDD:197706 22/76 (29%)
LsampXP_030104997.1 Ig 69..159 CDD:386229 33/93 (35%)
Ig_3 163..232 CDD:372822 24/89 (27%)
Ig_3 250..325 CDD:372822 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.