DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and NEGR1

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:253 Identity:65/253 - (25%)
Similarity:97/253 - (38%) Gaps:48/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIR-----L 154
            |..:..|||  |.|.|...:..|:.   |..|:..:.|..|.|.|.::...:|. :|:.     .
Human    21 LLSLCCLLP--SCLPAGQSVDFPWA---AVDNMMVRKGDTAVLRCYLEDGASKG-AWLNRSSIIF 79

  Fly   155 RDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTE--PKVSARVQLQVV 217
            ..|...:||..|.|:     .:.:.|  ::|||:.|...|.|.|.|.|.|:  |: :.:|.|.|.
Human    80 AGGDKWSVDPRVSIS-----TLNKRD--YSLQIQNVDVTDDGPYTCSVQTQHTPR-TMQVHLTVQ 136

  Fly   218 VPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNL-PEAS 281
            ||........|..|..|:||.|.|:..|..||.  |.|.|               :.|:. |..:
Human   137 VPPKIYDISNDMTVNEGTNVTLTCLATGKPEPS--ISWRH---------------ISPSAKPFEN 184

  Fly   282 GEGQSTIGSLIIESAKKRDTGNYTCSPSNS---PSATVTLNIINGESSASAVTSSAAT 336
            |:      .|.|....:...|.|.||..|.   |.......::|...:...:.|...|
Human   185 GQ------YLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 26/97 (27%)
Ig 127..217 CDD:299845 25/96 (26%)
IG_like 227..320 CDD:214653 24/96 (25%)
IGc2 234..311 CDD:197706 20/77 (26%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 26/96 (27%)
IGc2 152..210 CDD:197706 21/80 (26%)
Ig_3 225..301 CDD:372822 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.