DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Kirrel2

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_766486.1 Gene:Kirrel2 / 243911 MGIID:2442334 Length:700 Species:Mus musculus


Alignment Length:218 Identity:61/218 - (27%)
Similarity:85/218 - (38%) Gaps:53/218 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 IGTHAYLPCRVKQLG--NKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQP--DKYW-------- 183
            :|..|.|||   .||  ...|.|  .:||..|..:|.:            |  .:||        
Mouse    34 LGEEARLPC---ALGAYRGLVQW--TKDGLALGGERDL------------PGWSRYWISGNSASG 81

  Fly   184 --TLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVP--RTEILGEPDRYVKAGSNVVLRCIVR 244
              .|.||.|:..|..|||||.|.....|...||.|:||  ..::||.|...:.||....|.|..|
Mouse    82 QHDLHIKPVELEDEASYECQASQAGLRSRPAQLHV
MVPPEAPQVLGGPSVSLVAGVPGNLTCRSR 146

  Fly   245 GALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTI---------GSLIIESAKK-- 298
            |...|...::|:....:|...|....|..|    :|:|..::|:         |:.:|..|:.  
Mouse   147 GDSRPAPELLWFRDGIRLDGSSFHQTTLKD----KATGTVENTLFLTPSSHDDGATLICRARSQA 207

  Fly   299 ----RDTGNYTCSPSNSPSATVT 317
                |||. .|.|....|..|::
Mouse   208 LPTGRDTA-VTLSLQYPPMVTLS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 30/98 (31%)
Ig 127..217 CDD:299845 30/99 (30%)
IG_like 227..320 CDD:214653 26/106 (25%)
IGc2 234..311 CDD:197706 22/91 (24%)
Kirrel2NP_766486.1 IG 27..116 CDD:214652 30/98 (31%)
Ig 122..220 CDD:416386 25/102 (25%)
Ig strand A 123..126 CDD:409353 0/2 (0%)
Ig strand A' 129..133 CDD:409353 1/3 (33%)
Ig strand B 140..147 CDD:409353 2/6 (33%)
Cell attachment site. /evidence=ECO:0000255 146..148 1/1 (100%)
Ig strand C 153..158 CDD:409353 0/4 (0%)
Ig strand C' 161..163 CDD:409353 0/1 (0%)
Ig strand D 166..173 CDD:409353 1/6 (17%)
Ig strand E 180..188 CDD:409353 2/7 (29%)
Ig strand F 197..205 CDD:409353 2/7 (29%)
Ig strand G 211..217 CDD:409353 3/6 (50%)
Ig_3 223..292 CDD:404760 2/7 (29%)
Ig strand B 241..245 CDD:409353
Ig strand C 255..259 CDD:409353
Ig strand E 272..275 CDD:409353
Ig strand F 281..290 CDD:409353
Ig strand G 298..301 CDD:409353
Ig 315..392 CDD:416386
Ig strand A' 316..321 CDD:409353
Ig strand B 324..333 CDD:409353
Ig strand C 339..343 CDD:409353
Ig strand C' 346..348 CDD:409353
Ig strand D 351..354 CDD:409353
Ig strand E 355..360 CDD:409353
Ig strand F 368..376 CDD:409353
Ig strand G 382..392 CDD:409353
Ig 394..498 CDD:416386
Ig strand A 395..399 CDD:409353
Ig strand A' 401..404 CDD:409353
Ig strand B 412..419 CDD:409353
Ig strand C 426..431 CDD:409353
Ig strand C' 433..436 CDD:409353
Ig strand D 444..451 CDD:409353
Ig strand E 461..468 CDD:409353
Ig strand F 479..486 CDD:409353
Ig strand G 489..496 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..576
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 671..700
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.