DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Igsf9b

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:280 Identity:73/280 - (26%)
Similarity:101/280 - (36%) Gaps:83/280 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GTSEGAG----TSSASAASTAISSDESGDPSSATAFSSLAQVSSLLPEASALSATSGLVE--PYL 119
            ||..||.    .|..|...|::|.::.| ..:..|:|.         :..|:..|..||:  |::
Mouse   179 GTLLGASAKYQVSDGSLTVTSVSREDRG-AYTCRAYSI---------QGEAVHTTHLLVQGPPFI 233

  Fly   120 DGYATSNVTTQIGTHAYLPCRVKQL-GNKSVSW--------------IRLR---DGHILTVDRAV 166
            .. ...|:|..|...|.|.||.:.. ||.:.:|              :|:|   ||         
Mouse   234 VS-PPENITVNISQDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDG--------- 288

  Fly   167 FIADQRFLAIKQPDKYWTLQIKYVQARDAGSYEC----QVSTEPKVSARVQLQVVVPRTEILGEP 227
                             ||.|..|:..|||.|.|    .:...|..||  .|.|..|...:...|
Mouse   289 -----------------TLIIFRVKPEDAGKYTCVPSNSLGRSPSASA--YLTVQYPARVLNMPP 334

  Fly   228 DRYVKAGSNVVLRCIVRGALEPP-TFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSL 291
            ..||..|.:..:||.|..  ||| |.:.|......|         |::.||    |......||:
Mouse   335 VIYVPVGIHGYIRCPVDA--EPPATVVKWNKDGRPL---------QVEKNL----GWTLMEDGSI 384

  Fly   292 IIESAKKRDTGNYTCSPSNS 311
            .||.|.:...|.|||.|.|:
Mouse   385 RIEEATEEALGTYTCVPYNT 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 27/112 (24%)
Ig 127..217 CDD:299845 26/111 (23%)
IG_like 227..320 CDD:214653 28/86 (33%)
IGc2 234..311 CDD:197706 24/77 (31%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273
I-set 141..227 CDD:369462 13/57 (23%)
Ig 231..323 CDD:386229 28/120 (23%)
Ig <355..416 CDD:386229 19/63 (30%)
Ig 440..504 CDD:319273
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.