DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Iglon5

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:263 Identity:66/263 - (25%)
Similarity:91/263 - (34%) Gaps:82/263 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 EPYLDGYATSNVTTQIGTHAYLPCRVKQL---------GN------------KSVSWIRLRDGHI 159
            :||         |||:....::|.|:..:         ||            .:|:|.:||||  
Mouse   119 QPY---------TTQVYLIVHVPARIVNISSPVAVNEGGNVNLLCLAVGRPEPTVTWRQLRDG-- 172

  Fly   160 LTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYEC----QVSTEPKVSARVQLQVVVPR 220
                   |.::...           |:|..:|...||.|||    .|::.|. |.||.:.|..|.
Mouse   173 -------FTSEGEI-----------LEISDIQRGQAGEYECVTHNGVNSAPD-SRRVLVTVNYPP 218

  Fly   221 TEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEG- 284
            | |..........|...:|||  .....||....||..               |..|...|.|| 
Mouse   219 T-ITDVTSARTALGRAALLRC--EAMAVPPADFQWYKD---------------DRLLSSGSAEGL 265

  Fly   285 ----QSTIGSLIIESAKKRDTGNYTCSPSN---SPSATVTLNIINGESSASAVTSSAATTRAYAL 342
                :.|...|:..:...|..|||||..:|   :.||::.| :..|....||.......|...||
Mouse   266 KVQTERTRSMLLFANVSARHYGNYTCRAANRLGASSASMRL-LRPGSLENSAPRPPGPLTLLSAL 329

  Fly   343 SIL 345
            |.|
Mouse   330 SWL 332

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 27/115 (23%)
Ig 127..217 CDD:299845 27/114 (24%)
IG_like 227..320 CDD:214653 25/100 (25%)
IGc2 234..311 CDD:197706 22/84 (26%)
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 5/18 (28%)
Ig strand A' 41..46 CDD:409353
Ig strand B 48..56 CDD:409353
CDR1 56..60 CDD:409353
FR2 61..68 CDD:409353
Ig strand C 61..67 CDD:409353
CDR2 69..79 CDD:409353
Ig strand C' 71..74 CDD:409353
Ig strand C' 76..79 CDD:409353
FR3 80..115 CDD:409353
Ig strand D 84..91 CDD:409353
Ig strand E 94..100 CDD:409353
Ig strand F 107..115 CDD:409353