DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and CADM4

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_660339.1 Gene:CADM4 / 199731 HGNCID:30825 Length:388 Species:Homo sapiens


Alignment Length:349 Identity:73/349 - (20%)
Similarity:106/349 - (30%) Gaps:149/349 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 TSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVD----RAVF------IADQRFLAIKQ 178
            |.|||...|..|.:.||:.|.           ||.|:.:.    :.:|      :.|:||...:.
Human    29 TENVTVAEGGVAEITCRLHQY-----------DGSIVVIQNPARQTLFFNGTRALKDERFQLEEF 82

  Fly   179 PDKYWTLQIKYVQARDAGSYECQVSTE-----------------PKVSAR--------VQLQVVV 218
            ..:...:::...:..|.|.|.||:.||                 |.|..|        |:|..:|
Human    83 SPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVVEVREQAVEGGEVELSCLV 147

  Fly   219 PRT-------------EILG-------------------EPDR---------------------- 229
            ||:             |:.|                   ..||                      
Human   148 PRSRPAATLRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQALPSGHSK 212

  Fly   230 ---------------------YVKAGSNVVLRCIVRGALEP-PTFIMWYHGAEQLAADSRRHRTQ 272
                                 .|:.|..:||.|.|.|  .| |..|.|..|.|.|          
Human   213 QTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTG--NPRPNQIRWNRGNESL---------- 265

  Fly   273 LDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSASAVTSSAATT 337
              |...||.||      :|.:......|.|.|||..||.......|.::......:.|  .|.|:
Human   266 --PERAEAVGE------TLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVV--EAQTS 320

  Fly   338 RAYA-----LSILALLLSVILIGV 356
            ..||     |::|..|:..:|:|:
Human   321 VPYAIVGGILALLVFLIICVLVGM 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 27/125 (22%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 0/3 (0%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 30/136 (22%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 1/3 (33%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
CADM4NP_660339.1 Ig 29..120 CDD:472250 23/101 (23%)
Ig strand B 40..44 CDD:409353 1/3 (33%)
Ig strand C 53..57 CDD:409353 1/3 (33%)
Ig strand E 87..91 CDD:409353 0/3 (0%)
Ig strand F 101..106 CDD:409353 2/4 (50%)
Ig strand G 113..116 CDD:409353 0/2 (0%)
IgI_2_Necl-4 121..220 CDD:409468 12/98 (12%)
Ig strand A 121..124 CDD:409468 0/2 (0%)
Ig strand A' 127..131 CDD:409468 2/3 (67%)
Ig strand B 139..149 CDD:409468 3/9 (33%)
Ig strand C 152..161 CDD:409468 0/8 (0%)
Ig strand C' 162..165 CDD:409468 0/2 (0%)
Ig strand D 167..174 CDD:409468 1/6 (17%)
Ig strand E 177..187 CDD:409468 0/9 (0%)
Ig strand F 195..203 CDD:409468 0/7 (0%)
Ig strand G 212..219 CDD:409468 0/6 (0%)
Ig_3 224..295 CDD:464046 25/90 (28%)
4.1m 344..362 CDD:128590 0/1 (0%)

Return to query results.
Submit another query.